DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and prss56

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:345 Identity:92/345 - (26%)
Similarity:140/345 - (40%) Gaps:82/345 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CSPLMNILRPRGMTQAEK--DVFAHR------QCGLDPNGHELLHMVYV-CCPELGDVLPNKQTC 97
            || :.:.|.|.|....:|  .:.|.|      :|.|:.|      |.|: ..|:.|..:    ||
 Frog     5 CS-VYHQLCPEGNLTGDKCIQIMAGRCQLKLEECKLEMN------MDYLNTSPDDGSPV----TC 58

  Fly    98 GQ--------TTPVFRDRGAENAELNEYPWMVLLLYENRLS----LI--RYVLTAAHC------- 141
            ||        |.|..|..|........:||:|.:.:...|.    |:  .::||||||       
 Frog    59 GQKFSSISNNTGPKGRIVGGSITSPGSWPWLVNIRFNGELMCGGVLLDDMWILTAAHCFTGSVNE 123

  Fly   142 -----VIGGY-LTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDI 200
                 |:|.| ||:|       ..||.|              .:|.:...|..|...  |:.||:
 Frog   124 VLWTVVVGQYDLTKN-------AQGEKT--------------FQVNRIVTHPKFNQK--TFDNDL 165

  Fly   201 ALLRLQFPVRYTKKIQPICLLDA-EFPLQDLNLQISGW----DPTKSSQTLITSTVKERNPADCL 260
            |||.|...|..::..:|:||... ..|....|..|:||    :....|..::.:.|...:...|.
 Frog   166 ALLELTSSVTASQSARPVCLPPVPRDPTPGTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEACR 230

  Fly   261 NRY-PSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPG 323
            :.. .:..:::..|||....| |:|.|.||.|:  .....:.:...|.||.|:|.. |...|.||
 Frog   231 STLGKNMLTSTMFCAGYLNGGIDSCQGDSGGPL--TCQDPISKQYVLYGITSWGDG-CGERGKPG 292

  Fly   324 VYTKIGHFSEWI--KANLAP 341
            |||::..|::||  :.|.:|
 Frog   293 VYTRVTAFTDWISHQMNKSP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/50 (26%)
Tryp_SPc 108..338 CDD:238113 68/257 (26%)
Tryp_SPc 108..335 CDD:214473 66/252 (26%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.