powered by:
Protein Alignment CG18754 and LOC101731336
DIOPT Version :9
Sequence 1: | NP_652652.3 |
Gene: | CG18754 / 59145 |
FlyBaseID: | FBgn0042106 |
Length: | 341 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004916443.1 |
Gene: | LOC101731336 / 101731336 |
-ID: | - |
Length: | 300 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 20/42 - (47%) |
Gaps: | 2/42 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 FFNQLAECVRLSSCQKD-EKCTRLVSCSPLMNILRPRGMTQA 57
:|....:.|...:|:.: .:|..|:..|| .|||.....|||
Frog 220 YFQSSHQTVNKMACRGEMTQCADLIGASP-DNILMSGCATQA 260
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18754 | NP_652652.3 |
CLIP |
35..84 |
CDD:288855 |
10/23 (43%) |
Tryp_SPc |
108..338 |
CDD:238113 |
|
Tryp_SPc |
108..335 |
CDD:214473 |
|
LOC101731336 | XP_004916443.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.