DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:258 Identity:74/258 - (28%)
Similarity:119/258 - (46%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTT-PVFRDRGAENAELNEYPWMVLLLYEN------RLSLIRYVLTAAHCVIGGYLTQNDLVL 154
            ||.:| ...|..|..:|.:.::||.|.|.|::      .:....:::||||||.|.        .
 Frog   251 CGLSTYGESRIVGGSSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTAAHCVQGD--------T 307

  Fly   155 KSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPIC 219
            .|..|.::....|...|........|.:..||..::|.  |..|||||::|:..:.::...:|:|
 Frog   308 SSPSLWKAFIGKIKMPSYYDSSAYSVDRIIVHPDYSSQ--TNSNDIALMKLKTSIAFSSISRPVC 370

  Fly   220 LLDAEFPLQDLNLQ---ISGWDPTKSSQTLITSTVKER-----NPADCLNR---YPSFRSASQVC 273
            |  ..:.:|....|   ||||. |.|.:..|:|.:|..     :|..| |:   |....::|.:|
 Frog   371 L--PNYGMQWEEGQPCYISGWG-TTSQKGSISSVLKYAMVPLISPTTC-NQTIMYNGAITSSMIC 431

  Fly   274 AGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ||..:.| |:|.|.||.|::    :..:...:|.|..|:|.. |.:...||||..:..|.:||
 Frog   432 AGYPKGGVDSCQGDSGGPLV----TKTNSLWWLVGDTSWGDG-CANVYRPGVYGNMTVFLQWI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/246 (28%)
Tryp_SPc 108..335 CDD:214473 68/244 (28%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 2/3 (67%)
Tryp_SPc 261..489 CDD:238113 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.