DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and LOC100491119

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_004916446.1 Gene:LOC100491119 / 100491119 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:304 Identity:77/304 - (25%)
Similarity:119/304 - (39%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PNGHELLHMVYVCCPELGDVLPNKQTCGQ-TTPVFRDRGAENAELNEYPWMVLLLYENRL----S 130
            ||..|........||....|......||| :..:.|..|..::.|.::||.|.|.::.|.    |
 Frog   239 PNNLETFMSPVDICPTQEGVSLQCTDCGQAS
VDIPRIVGGTDSSLGKWPWQVSLRWDGRHMCGGS 303

  Fly   131 LI--RYVLTAAHC-VIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQG--FT 190
            :|  ::|::|||| |:.|:||                               |.:..:|.|  ..
 Frog   304 IISSQWVMSAAHCFVLNGFLT-------------------------------VSRWKIHAGSISL 337

  Fly   191 SSGGTY--RN--------------DIALLRLQFPVRYTKKIQPICLLDAEFPLQ-DLNLQISGW- 237
            |:|..|  ||              |:|||:...|:.::...:|:||..|....| ..|..|.|| 
 Frog   338 STGIAYSVRNIYYNGLYSLETNDYDVALLKTTVPMSFSDTTRPVCLPRAYQQFQVTANCWIIGWG 402

  Fly   238 --------DPT--KSSQTLITSTVKERNPADCLNRYPSFRSASQVCAG-GQRKGDTCAGISGSPV 291
                    .|.  ::...||:|.:...:     :.|....|...:||| ...:.|:|.|.||.|:
 Frog   403 HVSEGGQLSPVLQEAKVQLISSQICNHS-----SNYAGQISPRMLCAGYPDGRADSCQGDSGGPL 462

  Fly   292 MGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            :...|.    ..:..||.|:|:. |.....|||||.:....:|:
 Frog   463 VCQEGG----LWWQVGIVSWGEG-CGRPNRPGVYTNLTEVLDWV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 3/12 (25%)
Tryp_SPc 108..338 CDD:238113 67/266 (25%)
Tryp_SPc 108..335 CDD:214473 66/264 (25%)
LOC100491119XP_004916446.1 SRCR_2 172..269 CDD:373897 9/29 (31%)
Tryp_SPc 275..501 CDD:238113 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.