DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and proc.2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:321 Identity:83/321 - (25%)
Similarity:123/321 - (38%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TQAEKDVFA--HRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEY 117
            |...|.|:.  |....::|:.:.        .|: |||              |..|....||.:.
 Frog   406 TGTSKSVWEENHGLASVEPDDYN--------TPD-GDV--------------RIVGGMRCELGQC 447

  Fly   118 PWMVLLLYENR------LSLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCP 174
            ||.| |:..||      .|||  |:||:||||.                           ||:.|
 Frog   448 PWQV-LIRNNRGFGFCGGSLISSRWVLSAAHCF---------------------------ESQIP 484

  Fly   175 H-------------LD---VEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL--- 220
            |             :|   :.|.|...|..:.:.  .|.:|||||.|:.|..:.:..:||||   
 Frog   485 HHVTIGDYDTYRRDMDEQKIAVLQVFSHPNYLAE--FYDHDIALLFLRSPAMFGEYSRPICLPNP 547

  Fly   221 -LDAEFPLQDLNLQISGWDPTKSSQTLITSTVKERNP----ADCLNRYPSFRSASQVCAGGQRKG 280
             |......:....|:|||..|:.........:|.|.|    ..|:....:..:.:..|| |.::|
 Frog   548 GLGKMLTQEGQTGQVSGWGATRQFGPYTRFLLKVRLPIVSQETCMASTENILTGNMFCA-GYKEG 611

  Fly   281 --DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
              |.|:|.||.|...:.    .:..||.|:.|:|.. |...|..||||::.::..|||..:
 Frog   612 VKDACSGDSGGPFAVLF----HDTWFLVGVVSWGDG-CAEKGKYGVYTRVANYMPWIKETI 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 5/30 (17%)
Tryp_SPc 108..338 CDD:238113 73/263 (28%)
Tryp_SPc 108..335 CDD:214473 70/260 (27%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 73/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.