DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and tmprss12

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:309 Identity:88/309 - (28%)
Similarity:126/309 - (40%) Gaps:79/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLHMVYVCCPELGDVLP-NKQTCGQT----TPVFRDRGAENAELNEYPWMVLLLYENRL------ 129
            :||:....| .||.:.. :.:.||:.    ||..|..|..||....:||.|.|.|...|      
 Frog     7 MLHLTLSLC-WLGIIQAIDSEVCGEPPLVHTPGSRIVGGRNALPGAWPWQVSLQYFRTLSGYSHR 70

  Fly   130 ---SLIR--YVLTAAHC------------VIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLD 177
               |||:  :||:||||            |:|         |.::.:..|           |.:.
 Frog    71 CGGSLIQNNWVLSAAHCFRANRNPEYWRAVLG---------LHNIFMEGS-----------PVVK 115

  Fly   178 VEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTK- 241
            .::.|..:|..:.....|  ||||||.|...|.|:..|.|:||.....|.......|:||..|| 
 Frog   116 AKIKQIIIHASYDHIAIT--NDIALLLLHDFVTYSDYIHPVCLGSVTVPDSLTACFITGWGVTKE 178

  Fly   242 --SSQTLITSTVKERNP-ADC--LNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVD 300
              |...::...:.:..| ::|  .:.|..|.:.|.:|||..... |:|.|.||.|          
 Frog   179 KGSISVILQEALVQTIPYSECNSSSSYNGFITQSMICAGDNSGAVDSCQGDSGGP---------- 233

  Fly   301 EFV---------FLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
             ||         :..||.|:|.. |.....||||||:..:..||||::|
 Frog   234 -FVCYNTERMRFYQMGITSFGYG-CGKPNFPGVYTKVESYVSWIKAHMA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/7 (29%)
Tryp_SPc 108..338 CDD:238113 76/268 (28%)
Tryp_SPc 108..335 CDD:214473 73/265 (28%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 76/270 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.