DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and zgc:165423

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:276 Identity:76/276 - (27%)
Similarity:121/276 - (43%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DVLPNKQ--TCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL-----SLI--RYVLTAAHCVIG 144
            |..|.:.  .||:.....:..|..||....:||.. .|:|:..     |||  :::|:||||   
Zfish    19 DCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQA-SLHESGSHFCGGSLISDQWILSAAHC--- 79

  Fly   145 GYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209
             :.:..:....:|.||..:.|.....    .:...|.|..||..:  .|.|:.||:|||.|..||
Zfish    80 -FPSNPNPSDYTVYLGRQSQDLPNPN----EVSKSVSQVIVHPLY--QGSTHDNDMALLHLSSPV 137

  Fly   210 RYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTL--------ITSTVKERNPADCLNRYPSF 266
            .::..|||:||........:..:.|:||...:|..:|        :...:...|..:||....|.
Zfish   138 TFSNYIQPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSS 202

  Fly   267 RSASQVCAGGQRKG-DTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIG 329
            .:.:.:|||..:.| |:|.|.||.| |:....:.|.     ||:.|:|:. |.....||||.::.
Zfish   203 ITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQ-----AGVVSFGKG-CADPNYPGVYARVS 261

  Fly   330 HFSEWI----KANLAP 341
            .:..||    :|:..|
Zfish   262 QYQNWISQYVRASFIP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/250 (28%)
Tryp_SPc 108..335 CDD:214473 68/243 (28%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 68/246 (28%)
Tryp_SPc 38..269 CDD:238113 70/247 (28%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.