DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and ARRDC4

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_899232.2 Gene:ARRDC4 / 91947 HGNCID:28087 Length:418 Species:Homo sapiens


Alignment Length:430 Identity:117/430 - (27%)
Similarity:182/430 - (42%) Gaps:76/430 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGF 71
            ::|.:..:|.:.:|:.|||.|.|...:.:.::|:||:.:|.|...|..|.....:.||:......
Human    22 LVFEDERKGCYSSGETVAGHVLLEASEPVALRALRLEAQGRATAAWGPSTCPRASASTAALAVFS 86

  Fly    72 E-KYLSSKVYL----LGSEISPEMALEPGTRSYNFACPIPIN-CPSSFEGTHGRIRYMVDVNIIQ 130
            | :||:.::.|    .|..|   :.|:||...:.|...:|.. ..:||.|.:|.|:|.|...:.:
Human    87 EVEYLNVRLSLREPPAGEGI---ILLQPGKHEFPFRFQLPSEPLVTSFTGKYGSIQYCVRAVLER 148

  Fly   131 PWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQT 195
            |...|....|...|:..:|:||  .....||....||..|.|.|.|.|::|...:.:.|:..|:.
Human   149 PKVPDQSVKRELQVVSHVDVNT--PALLTPVLKTQEKMVGCWFFTSGPVSLSAKIERKGYCNGEA 211

  Fly   196 VPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMYDFQ-L 258
            :|....|.|.|. |:...|..:....||   |:|| :|..|..||.::.:.:...|...::.: |
Human   212 IPIYAEIENCSS-RLIVPKAAIFQTQTY---LASGKTKTIRHMVANVRGNHIASGSTDTWNGKTL 272

  Fly   259 MIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGT----LIMPVTICGVPI-------SPSAVQ 312
            .||...||....| ||::.|.:.|.     :||.|.    |.:|:.|..:|.       |..|.|
Human   273 KIPPVTPSILDCC-IIRVDYSLAVY-----IHIPGAKKLMLELPLVIGTIPYNGFGSRNSSIASQ 331

  Fly   313 YTPQSS--------GPEAPEQRALTLIEGEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEK 369
            ::...|        .||||...|..:.|.|  |:...||||       .|||.            
Human   332 FSMDMSWLTLTLPEQPEAPPNYADVVSEEE--FSRHIPPYP-------QPPNC------------ 375

  Fly   370 QSESGNA--------QEKSYK--PLYPVFDLSTSTVEKSK 399
               .|..        ||..::  |||...|...|.||:|:
Human   376 ---EGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQ 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 40/149 (27%)
Arrestin_C 175..301 CDD:280848 36/131 (27%)
ARRDC4NP_899232.2 Arrestin_N 26..169 CDD:278754 39/145 (27%)
Arrestin_C 191..318 CDD:214976 37/136 (27%)
PPxY motif 1. /evidence=ECO:0000305 350..353 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 395..398 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8525
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.