DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and ECM21

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_009449.1 Gene:ECM21 / 852173 SGDID:S000000197 Length:1117 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:74/400 - (18%)
Similarity:139/400 - (34%) Gaps:117/400 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FEKYLSSKVYLLGSEISPEMALEPGTRSYN--------FACPIPINCP---SSFEGTHGRIRYMV 124
            |..::...:||..:.:|..:.|  .|::.|        ...|.||..|   ||...|...:: :.
Yeast   454 FSNHIPETIYLPSARVSYRLRL--ATKAINRKGFYRQDSNSPQPIVSPDSSSSLSSTTSSLK-LT 515

  Fly   125 DVNIIQPWK--YDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFR------------ 175
            :....|..:  .:::||:....:.:......|.      ::..|..|..:|.:            
Yeast   516 ETESAQAHRRISNTLFSKVKNHLHMSSHQLKNE------ESGEEDIFAEYPIKVIRTPPPVAVST 574

  Fly   176 -----------SDPLTLELNLPQTGFVPGQTVPANVLIGNESK-IRVHEVKVGLSMMITYYSDLS 228
                       :|.|:.|::..|........||..:.:....| :.|..:.|.::..:|:   :|
Yeast   575 ANKPIYINRVWTDSLSYEISFAQKYVSLNSEVPIKIKLAPICKNVCVKRIHVSITERVTF---VS 636

  Fly   229 SGSKCERKSVAKLKADGVLRNSRKMYDFQLMIPSTPPSCFHLC--------RIIKIGYQIEVVAK 285
            .|.:.|                   ||....:...|.:.::|.        |.:.:   .|:..|
Yeast   637 KGYEYE-------------------YDQTDPVAKDPYNPYYLDFASKRRKERSVSL---FEIRTK 679

  Fly   286 VKGMHINGTLIMPVTICGVPISPSAVQYTP---QSSGPEAPEQR-ALT---LIEGEGAF------ 337
            .|     ||..:...|.....:.:.:.|:|   .|.....|::| .:|   :||.:..|      
Yeast   680 EK-----GTRALREEIVENSFNDNLLSYSPFDDDSDSKGNPKERLGITEPIIIETKLKFPKYEDL 739

  Fly   338 ----APAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQSE-----SGNAQEKSY----KPLY-PVF 388
                |...|||.....:::..|.:|.|   :..|.::..     ||:...||:    ||:| |.|
Yeast   740 DKRTAKIIPPYGIDAYTSIPNPEHAVA---NGPSHRRPSVIGFLSGHKGSKSHEENEKPVYDPKF 801

  Fly   389 DLSTSTVEKS 398
            .   .|:.||
Yeast   802 H---QTIIKS 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 17/92 (18%)
Arrestin_C 175..301 CDD:280848 23/157 (15%)
ECM21NP_009449.1 Arrestin_C 585..>648 CDD:214976 15/84 (18%)
Arrestin_C <781..878 CDD:413500 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.