DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and ROG3

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_116677.3 Gene:ROG3 / 850578 SGDID:S000001918 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:487 Identity:97/487 - (19%)
Similarity:170/487 - (34%) Gaps:133/487 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MVAGQVTLSTDKAIQIKAIRLKLKGYAETHW-TESKTDSNNKSTSES-----------YN----- 69
            :::|.:.||.::.:|||:|.|:|.|..:... .|...|:::.|.|.|           ||     
Yeast    41 LLSGCIVLSINEPMQIKSISLRLYGKIQIDVPLERPQDASSSSLSSSPPKIRKYNKVFYNYAWDN 105

  Fly    70 -GFEKYL----------------------------SSKVYLLGSEISPEMALEPGTRSYNFACPI 105
             ..::||                            ||...|.||.......|:.|...:.|:..:
Yeast   106 VNLKEYLSGLRGQSGLAGSSSSSNILGTRQRAQSTSSLKSLKGSSSPSSCTLDKGNYDFPFSAIL 170

  Fly   106 PINCPSSFEG-THGRIRYMVDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQ-AKTEKT 168
            |.:.|.|.|. .:..:.|.::..|.:...|..:..|       .:|....::|...|: ::|...
Yeast   171 PGSLPESVESLPNCFVTYSMESVIERSKNYSDLICR-------KNIRVLRTISPAAVELSETVCV 228

  Fly   169 FGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNESK-IRVHEVKVGLSMMITY-YSDLSSGS 231
            ...||   |.:...:::|......|...|.|:.|...|| :::..:||.|  ...| |.|.....
Yeast   229 DNSWP---DKVDYSISVPNKAVAIGSATPINISIVPLSKGLKLGSIKVVL--FENYQYCDPFPPV 288

  Fly   232 KCERKSVAKLKADGVLRNS----------------RKMYDFQ--------LMIPSTPPSCFHLCR 272
            ..|.:.|.:|..:..|..|                :..:.||        |.||::..:|...|.
Yeast   289 ISENRQVTELNLEDPLNESSGEFNGNGCFVNNPFFQPDHSFQDKWEIDTILQIPNSLSNCVQDCD 353

  Fly   273 I---IKIGYQIE---VVAKVKGMHINGTLIMPVTI-----CGVPISP----------SAVQYTPQ 316
            :   ||:.::::   ::....|........:|:.:     ..:.|.|          |......:
Yeast   354 VRSNIKVRHKLKFFIILINPDGHKSELRASLPIQLFISPFVALSIKPLSSSNLYSLFSTTNQKDE 418

  Fly   317 SSGPEAPEQ------RALTLIE-----GEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQ 370
            :|..|..|:      .::|.:|     ..|...|..       ...::||||  .||.:......
Yeast   419 NSSQEEEEEYLFSRSASVTGLELLADMRSGGSVPTI-------SDLMTPPNY--EMHVYDRLYSG 474

  Fly   371 SESGNAQEKS--YKPLYPVFDLSTSTVEKSKE 400
            |.:..|.|.|  ..||    ....||||..::
Yeast   475 SFTRTAVETSGTCTPL----GSECSTVEDQQQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 35/175 (20%)
Arrestin_C 175..301 CDD:280848 30/157 (19%)
ROG3NP_116677.3 Arrestin_N <156..215 CDD:419887 12/65 (18%)
Arrestin_C 232..393 CDD:214976 32/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.