DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and LOC799768

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_009300042.3 Gene:LOC799768 / 799768 -ID:- Length:377 Species:Danio rerio


Alignment Length:354 Identity:81/354 - (22%)
Similarity:142/354 - (40%) Gaps:50/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLS 76
            |....|.:|.:|.|:|.|...|.:.:.::.:|..|.|:.:|||.::         .|:..|:|..
Zfish    39 NESNTFNSGDIVEGRVLLEVTKNLTVDSLFVKFTGGAKVYWTEGES---------KYHDHERYFK 94

  Fly    77 SKVYLL-GSEISPEMALEPGTRSYNFACPIP-INCPSSFE----GTHGRIRYMVDVNIIQPWKYD 135
            .|..|. |........:.||.....|...:| .|.|.||:    |.:..|||.:...:.:|:|..
Zfish    95 LKQDLTPGRSGKERQIISPGRHVLPFKFQLPEQNLPPSFKEKVSGFNCWIRYALTAKLKRPFKSA 159

  Fly   136 SIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANV 200
            |......|.:....:...:.:..   |.:|:|....  |.|..::|.....:||::.|:|:...|
Zfish   160 STAYAELTFVPRSHVTNDHLLKP---QNRTDKMKNT--FSSGKISLTATTDKTGYMLGETIKVCV 219

  Fly   201 LIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDFQLMIPSTPP 265
            .|.|.|. |..::|..|.....:   ::|.:....|.:.:..:|.:....::.:...:.:|....
Zfish   220 DIDNASS-RDAKLKYSLKQQQMF---IASRTTKRSKHIIQETSDCIPSGEKRRFLVNIKLPRDIM 280

  Fly   266 SCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSGPEAPEQRALTL 330
            ..|..||||::.|.::|...| ....:..:..||.|    |.|  :|..|....|..|       
Zfish   281 VSFENCRIIRVLYLLKVSLDV-SFASDPAVKFPVVI----IPP--LQQCPPWQDPPPP------- 331

  Fly   331 IEGEGAFAPAAP-PYPWSEGSTLSPPNYA 358
                  :.|..| |:|..     :||.:|
Zfish   332 ------YMPPQPVPHPGG-----APPPFA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 36/144 (25%)
Arrestin_C 175..301 CDD:280848 27/125 (22%)
LOC799768XP_009300042.3 Arrestin_N 39..158 CDD:328947 33/127 (26%)
Arrestin_C 194..319 CDD:308405 30/135 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.