DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and si:ch211-130m23.2

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001108161.1 Gene:si:ch211-130m23.2 / 794173 ZFINID:ZDB-GENE-060531-13 Length:441 Species:Danio rerio


Alignment Length:394 Identity:92/394 - (23%)
Similarity:164/394 - (41%) Gaps:61/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIICQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTS 65
            :.:|...:..|||   |.:|..::|||.|...|..|::::.:|:||.|...|:|     :...|:
Zfish     8 ISVIYNPINQNNT---FTSGDYISGQVILDVVKDTQMQSLSVKIKGKANVCWSE-----HYGKTT 64

  Fly    66 ESYNGFEKYLSSKVYLLGSEISP----EM-----------ALEPGTRSYNFACPIPI-NCPSSFE 114
            ..|:..||:.|.:.:.:.::...    ||           .:.||...|.|...:|: :.|||.:
Zfish    65 VCYSDKEKFYSVERFFVRTDTKQGTDHEMLKDPSGQPYSSVVAPGRHLYPFTFQLPLQHFPSSLK 129

  Fly   115 GTHGRIRYMVDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPL 179
            |:.|::.|.::..:.:..:..|.....|..:...||:  |.....|.....:|....  |.|..:
Zfish   130 GSVGKVLYTLETKLCRSLRVSSKAKAEFNYVPSADIS--NPELMAPQYGTIDKQMKF--FNSGNV 190

  Fly   180 TLELNLPQTGFVPGQTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERK----SVAK 240
            ::.::..:..:..|:.:.....|.|.|. |:.:.|..|      |...|..:|..||    .:.|
Zfish   191 SMNISTEKMAYYLGEGLKVLAEIHNGSS-RIIKPKYCL------YEKYSFFAKGRRKIHTHDLLK 248

  Fly   241 LKADGVLRNSRKMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVP 305
            ...:.|..||:|.....|.||.:..:....|||:|:.|::.|...|| ...:..:.:|:.:  :|
Zfish   249 EVGESVEPNSKKTITTVLTIPPSLTASILNCRILKVEYRLRVYLDVK-YASDPEIKLPIVV--LP 310

  Fly   306 ISPSA-------------VQYTPQSSGPE----APEQRALTLIEGEGAFAPAAPPYPWSEGSTLS 353
            :.|.:             .|..|.|:||.    ||..::..:....|..  .||.||.......|
Zfish   311 LQPVSGANGSTKSDFGIWNQPQPGSAGPNPPPTAPSAQSQNIAGPPGQL--GAPDYPGPPVGQFS 373

  Fly   354 PPNY 357
            ||:|
Zfish   374 PPSY 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 38/161 (24%)
Arrestin_C 175..301 CDD:280848 30/129 (23%)
si:ch211-130m23.2NP_001108161.1 Arrestin_N 16..166 CDD:304627 38/157 (24%)
Arrestin_C 187..309 CDD:280848 30/131 (23%)
Collagen 333..408 CDD:189968 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579452
Domainoid 1 1.000 65 1.000 Domainoid score I10012
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.