DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Arrdc5

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_084075.1 Gene:Arrdc5 / 76920 MGIID:1924170 Length:325 Species:Mus musculus


Alignment Length:274 Identity:55/274 - (20%)
Similarity:112/274 - (40%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYL-SSKV 79
            |:.||.::.|||.|:.:..:....::::|.|.....|.|...::.:.|.....|....|: .:|.
Mouse    16 VYLAGSIIDGQVVLTLNSTLVDPVVKVELVGRGYVEWNEEIGETRDYSRDVICNNKADYVHKTKT 80

  Fly    80 YLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTV 144
            :.:     .:..|..|:.:::|...:|...||:|....|.|.|.|....:.   .:.|.::....
Mouse    81 FPI-----KDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQALCLD---REHILAKKKLY 137

  Fly   145 IQVMDINTYN----SVSQVPVQAKTEKTFGV----WPFRSDPLTLELNLPQTGFVPGQTVPANVL 201
            :.|..|:.:.    |.:.|.|:|:.:.::..    |      ::|.:.:.:..:|||:.|.....
Mouse   138 LLVQGISEFRQRNLSENSVSVEAEKKVSYNCCSQGW------VSLHVQMSKNTYVPGEKVTFTSE 196

  Fly   202 IGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDFQLMIP----S 262
            |.|.:...:..|...|...:.|.....|..:..|...::|...  :.|:|        ||    :
Mouse   197 IRNHTGKYIKTVVFALYAHVQYEGFTPSAERRRRADSSELLRQ--MANAR--------IPAFNST 251

  Fly   263 TPPSCFHLCRIIKI 276
            |..|.|:|..::.:
Mouse   252 TVVSAFNLPLVLSV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 28/135 (21%)
Arrestin_C 175..301 CDD:280848 21/106 (20%)
Arrdc5NP_084075.1 Arrestin_N 13..128 CDD:304627 26/119 (22%)
Arrestin_C 170..304 CDD:280848 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.