DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Arrdc5

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001102878.1 Gene:Arrdc5 / 680452 RGDID:1591748 Length:325 Species:Rattus norvegicus


Alignment Length:308 Identity:62/308 - (20%)
Similarity:124/308 - (40%) Gaps:40/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYL-SSKV 79
            |:.||..:.|||.|:.:..:....::::|.|.....|.|...::.:.|.....|....|: .:|.
  Rat    16 VYLAGSNIDGQVVLTLNSTLVDPVVKVELVGRGYVEWNEEIGETRDYSRDVICNNKADYVHKTKT 80

  Fly    80 YLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTV 144
            :.:     .:..|..|:.:::|...:|...||:|....|.|.|.|.. :....::.....|.:.:
  Rat    81 FPI-----KDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQA-LCMGREHILAKKRLYLL 139

  Fly   145 IQVMDINTYNSVSQVPVQAKTEKTFGV------WPFRSDPLTLELNLPQTGFVPGQTVPANVLIG 203
            :|.:......::|:.|:..:.||....      |      ::|.:.:.:..||||:.|.....|.
  Rat   140 VQGISEFRQRNLSENPLSVEAEKKVSYNCCSRGW------VSLHVQMSKNTFVPGEKVTFTSEIR 198

  Fly   204 NESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDFQLMIP----STP 264
            |.:...:..|...|...:.|.....|..:..|...::|...  :.|:|        ||    :|.
  Rat   199 NHTGKYIKTVVFALYAHVQYEGFTPSAERRRRADSSELLRQ--MANAR--------IPAFNSTTV 253

  Fly   265 PSCFHLCRIIKI--GYQIEVVAKVKGMHINGTLIMPVTI----CGVPI 306
            .|.|:|..::.:  |.|...:.:. ...:..|:.:|.::    .|:||
  Rat   254 VSAFNLPLVLSVSSGSQENEIMRT-SYELVVTIHLPWSLSTVKAGLPI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 28/135 (21%)
Arrestin_C 175..301 CDD:280848 26/131 (20%)
Arrdc5NP_001102878.1 Arrestin_N 13..124 CDD:419887 26/113 (23%)
Arrestin_C 170..304 CDD:397050 30/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339680
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.