DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Arrdc4

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001036057.1 Gene:Arrdc4 / 66412 MGIID:1913662 Length:415 Species:Mus musculus


Alignment Length:419 Identity:108/419 - (25%)
Similarity:181/419 - (43%) Gaps:77/419 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESK------TDSNNKSTS 65
            ::|.:.::|.:.:|:.|||.|.|...:.:.::.:||:.:|.|.:.|..|.      ...:..::|
Mouse    19 LVFEDESKGCYSSGETVAGHVLLEAAEPVALRGLRLEAQGRATSAWGPSAGARVCIGGGSPAASS 83

  Fly    66 ESYNGFEKYLSSKVYLLGSEISPEMA-LEPGTRSYNFACPIPIN-CPSSFEGTHGRIRYMVDVNI 128
            |     .:||:.::.||.:.....:. |:||...:.|...:|.. ..:||.|.:|.|:|.|...:
Mouse    84 E-----VEYLNLRLSLLEAPAGEGVTLLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVL 143

  Fly   129 IQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPG 193
            .:|...|....|...|:..:|:||...::  |:....||..|.|.|.|.|::|.:.:.:.|:..|
Mouse   144 ERPQVPDQSVRRELQVVSHVDVNTPPLLT--PMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNG 206

  Fly   194 QTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMYDFQ 257
            :.:|....|.|.|. |:...|..:....||   |:|| :|..|..||.::.:.:...|...::.:
Mouse   207 EAIPIYAEIENCSS-RLVVPKAAIFQTQTY---LASGKTKTVRHMVANVRGNHIGSGSTDTWNGK 267

  Fly   258 LM-IPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGT----LIMPVTICGVPI-------SPSA 310
            :: ||...||....| ||::.|.:.|.     :||.|.    |.:|:.|..:|.       |..|
Mouse   268 MLKIPPVTPSILDCC-IIRVDYSLAVY-----IHIPGAKRLMLELPLVIGTIPYSGFGRRNSSVA 326

  Fly   311 VQYT----------PQSSGPEAPEQRALTLIEGEGAFAPAAPPYPW----------------SEG 349
            .|::          |:.  ||||...|..:.|.|  |:...||||.                .|.
Mouse   327 SQFSMDMCWLALALPEQ--PEAPPNYADVVSEEE--FSRHVPPYPQPSDCDGEACYSMFACIQEF 387

  Fly   350 STLSPPNYAEAMHSHSDSEKQSESGNAQE 378
            ....||.|         ||.....|:|||
Mouse   388 RFQPPPLY---------SEVDPHPGDAQE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 37/151 (25%)
Arrestin_C 175..301 CDD:280848 35/131 (27%)
Arrdc4NP_001036057.1 Arrestin_N 19..166 CDD:306778 37/151 (25%)
Arrestin_C 188..315 CDD:214976 36/136 (26%)
PPxY motif 1. /evidence=ECO:0000305 347..350 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 392..395 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10262
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.