DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and CG18745

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_652648.1 Gene:CG18745 / 59141 FlyBaseID:FBgn0042102 Length:433 Species:Drosophila melanogaster


Alignment Length:403 Identity:171/403 - (42%)
Similarity:255/403 - (63%) Gaps:19/403 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIICQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTS 65
            |.:.|:|.|.||..|.::.|:::.|:|||..||...:|||.|.:.|||||.|.|..| :|.:...
  Fly     1 MTVTCEIDFDNNPHGTYFGGEVLTGRVTLKLDKMKLVKAITLNITGYAETRWIERVT-TNRRRRR 64

  Fly    66 ESYNGFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQ 130
            .::.|.|.|::||.:|:||.:|.::::|.|..:|||.|.||..|||||||:|||:|||..|.:::
  Fly    65 RTFCGREDYIASKTFLVGSNLSSQVSIEAGIHTYNFVCLIPTECPSSFEGSHGRVRYMATVTLVR 129

  Fly   131 PWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQT 195
            |||:|..::|.|||::|||:|..:.:.:||..::|.||:..||.|||||.|:|.:|||||||||.
  Fly   130 PWKFDQSYTRCFTVLKVMDLNFDSPLLRVPAHSETSKTYCCWPCRSDPLALQLTVPQTGFVPGQN 194

  Fly   196 VPANVLIGNESKIRVHEVKVGLSMMITYYSDLSS--GSKCERKSVAKLKADGVLRNSRKMYDFQL 258
            ||.:||:.|:|.|.|.::.:...|::||:|...|  .:..||..|...|.|.|.||.:|::.:::
  Fly   195 VPLSVLVTNDSHIPVEQLLISFVMLVTYHSKPPSMPNTTSERLVVNTFKGDAVQRNCKKLFSYEI 259

  Fly   259 MIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSGPEAP 323
            .:|:|||:||:||.||:|.||:||.|:|||.|.|..:.:|:||..||::    |:.|.......|
  Fly   260 RVPATPPTCFNLCGIIQIAYQVEVEARVKGCHNNEVVTIPLTIGSVPLA----QHVPIQPRGFVP 320

  Fly   324 EQRALTLIEGEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQSESGNAQEK--------- 379
            :.....|...|.|.||.:.. |||..:::.||||.||:|..|.:..:|:..:..|.         
  Fly   321 QLNVNELAVEEVATAPNSSS-PWSVDASIPPPNYQEAVHMRSTAATRSDDLDDPEPVPPNTLSLD 384

  Fly   380 --SYKPLYPVFDL 390
              :|||||||||:
  Fly   385 GGAYKPLYPVFDI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 68/145 (47%)
Arrestin_C 175..301 CDD:280848 60/127 (47%)
CG18745NP_652648.1 Arrestin_N 5..150 CDD:278754 68/145 (47%)
Arrestin_C 174..304 CDD:280848 62/129 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464035
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 1 1.000 - - H119234
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
1110.900

Return to query results.
Submit another query.