DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrdc1b

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001352163.1 Gene:arrdc1b / 570029 ZFINID:ZDB-GENE-080515-2 Length:443 Species:Danio rerio


Alignment Length:415 Identity:110/415 - (26%)
Similarity:177/415 - (42%) Gaps:63/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNG 70
            :|.|.|| :.|:..|:.::|.|.:.:..::|.|||::...|         ....::|....|:..
Zfish     8 EITFTNN-KVVYNPGESISGTVRIKSSHSLQFKAIKVCCVG---------SCGISSKLNDASWML 62

  Fly    71 FEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQP-WKY 134
            .||||||.:     .::.:..|.||..|:.|...||.:.|:||||..|:|.|.:...|..| :..
Zfish    63 EEKYLSSTL-----SVADKGTLPPGEHSFPFQFLIPASVPTSFEGPFGKILYKIRAFIDTPRFSK 122

  Fly   135 DSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPAN 199
            |....|.|.::.|:::|....:.| |..|.|.|.|.....::..|.|:......|:.|||.:..:
Zfish   123 DYK
AQRPFYLLNVLNLNELPDIEQ-PSCAVTTKKFNYLLVKTGTLMLKAYTDLRGYTPGQVIKLS 186

  Fly   200 VLIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCER-----KSVAKLKADGVLRNSRKMYDFQLM 259
            ..|.|:|......|...|...::|        |.:|     :.:|:::..||.......:..|::
Zfish   187 AEIHNKSGKDTGYVMASLIQRVSY--------KTKRPVFDLRPIAEVEGAGVKAGKHAEWREQII 243

  Fly   260 IPSTPPSCFHLCRIIKIGYQIEVVAK-----------VKGMHINGTLIMPVTIC-GVPISPSAVQ 312
            :|..|.|....|.:|.|.|.|:|..|           :..:.:|.|..:|..:. |||: |:...
Zfish   244 VPPLPQSGLTGCNLIDIEYFIQVSLKSPEAAVTLPIYIGNIAVNLTPSIPHPMAHGVPM-PTGPS 307

  Fly   313 YTPQSSGPEAP---EQRALTLIEGEGAFAPAAPPYPWSE----GSTLSPPNYAEA---MHSHSDS 367
            ..|.:..|.||   |:.|..|..| |..:...|....|:    |:.||...|..|   :...|..
Zfish   308 LNPAAVVPSAPPVEEELAGQLAAG-GGDSEEIPTKSHSQQDPSGAPLSVAPYGHASGPVLPQSQQ 371

  Fly   368 EKQSESGNAQEKSYKPLYPVFDLST 392
            ..||..|:|         |:|.|||
Zfish   372 HVQSTDGSA---------PLFCLST 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 42/145 (29%)
Arrestin_C 175..301 CDD:280848 31/141 (22%)
arrdc1bNP_001352163.1 Arrestin_N 7..125 CDD:328947 39/131 (30%)
Arrestin_C 162..284 CDD:308405 28/129 (22%)
Atrophin-1 <293..426 CDD:331285 31/106 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.