DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrdc3a

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001073498.1 Gene:arrdc3a / 566685 ZFINID:ZDB-GENE-030131-2913 Length:414 Species:Danio rerio


Alignment Length:412 Identity:106/412 - (25%)
Similarity:190/412 - (46%) Gaps:58/412 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVY 80
            ||.:|..|:|:|.:.....|::|::::..||:|:..||||:...::.:.:::|....:||:.:..
Zfish    23 VFSSGDSVSGRVIIEVTGEIRVKSLKINAKGFAKVRWTESRNAGSSTAYTQNYTEEVEYLNHRDI 87

  Fly    81 LLGSEISPE------MALEPGTRSYNFACPIPINCP--SSFEGTHGRIRYMVDVNIIQPWKYDSI 137
            |:|.|...:      ..:..|...|.|:..:| ..|  :||||.||.:||.|...:.:||.....
Zfish    88 LIGHERDDDNSEEGLTTIHSGRHEYAFSFELP-QTPLATSFEGKHGSVRYWVKAELHRPWLLPMK 151

  Fly   138 FSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLI 202
            ..:.|||.:.:||||...:|  |.....|||...|...|.|::|...:.:.|:.||:::.....|
Zfish   152 TKKEFTVFEHIDIN
TPLLLS--PQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQIFAEI 214

  Fly   203 GNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKS-VAKLKADGVLRNSRKMYDFQLM-IPSTPP 265
            .|.|. |:...|..:....|::   :.|...|.|. ||.::.:.:.....:.::.::: ||...|
Zfish   215 ENCSS-RMVVPKAAIYQTQTFF---AKGKMKEIKQLVANIRGESLSSGKTETWNGKMLKIPPVSP 275

  Fly   266 SCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSGPEAPEQRALTL 330
            |... |.||::.|.:.|...:.|. :|.:|.:|:.|..:|:.|...:.:..||      |.::|:
Zfish   276 SILD-CSIIRVEYSLMVYVDIPGA-MNLSLNLPLVIGTIPLHPFGSRTSSVSS------QCSMTM 332

  Fly   331 IEGEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQS--ESGNAQEKSYKPLY-------- 385
             ...|...|..|.         :||.|||.:   ::.::|:  |....:|....||:        
Zfish   333 -SWLGMALPERPE---------APPAYAEVV---TEEQRQNCLEVSPGRENYDGPLFAYIQEFRF 384

  Fly   386 ----------PVFDLSTSTVEK 397
                      |..|.:|||.|:
Zfish   385 RPPPPYSEIDPHPDQATSTAEQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 41/142 (29%)
Arrestin_C 175..301 CDD:280848 30/127 (24%)
arrdc3aNP_001073498.1 Arrestin_N 22..165 CDD:278754 41/142 (29%)
Arrestin_C 188..311 CDD:280848 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.