DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Txnip

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001009935.1 Gene:Txnip / 56338 MGIID:1889549 Length:397 Species:Mus musculus


Alignment Length:397 Identity:83/397 - (20%)
Similarity:165/397 - (41%) Gaps:69/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNG 70
            :::| |:.:.|:.:|:.|||:|.:...:..::||:|:...|.|:..|.:.....  |.|.:    
Mouse    11 EVVF-NDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQC--KQTLD---- 68

  Fly    71 FEKYLSSKVYLLGSEISP-----EMA-LEPGTR-SYNFACPIPIN-CPSSFEGTHGRIRYMVDVN 127
               ||..:..||..| .|     ||. :.||.: .|.|...:|.. ..:||:|.:|.:.|.|...
Mouse    69 ---YLRYEDTLLLEE-QPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAF 129

  Fly   128 IIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVP 192
            :.:|.:......:.|.|:.::|:||.:.::  ||.||.||...........:::...:.:.||..
Mouse   130 LDRPSQPTQEAKKNFEVMDLVDVN
TPDLMA--PVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCE 192

  Fly   193 GQTVPANVLIGNE-SKIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMY- 254
            |..:..:....|. |:|.|.:..:     :..::.|::| :|...:.::.::.:.::..:...: 
Mouse   193 GDDISIHADFENTCSRIVVPKAAI-----VARHTYLANGQTKVFTQKLSSVRGNHIISGTCASWR 252

  Fly   255 DFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTI------------------ 301
            ...|.:....||... |.|:|:.|.:.:...|.|.. ...|.:|:.|                  
Mouse   253 GKSLRVQKIRPSILG-CNILKVEYSLLIYVSVPGSK-KVILDLPLVIGSRSGLSSRTSSMASRTS 315

  Fly   302 -------CGVPISPSA----VQYTPQSSGPEAPEQRALTLIEGEGAFAPA---APPYPWSEGSTL 352
                   ..:|.:|.|    :...|:....|:|....|..:: :...:|.   ||.:.:     :
Mouse   316 SEMSWIDLNIPDTPEAPPCYMDIIPEDHRLESPTTPLLDDVD-DSQDSPIFMYAPEFQF-----M 374

  Fly   353 SPPNYAE 359
            .||.|.|
Mouse   375 PPPTYTE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 39/152 (26%)
Arrestin_C 175..301 CDD:280848 21/128 (16%)
TxnipNP_001009935.1 Arrestin_N 10..153 CDD:304627 39/152 (26%)
Arrestin_C 175..299 CDD:280848 22/130 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10262
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.