DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and zgc:110353

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001017785.1 Gene:zgc:110353 / 550482 ZFINID:ZDB-GENE-050417-310 Length:319 Species:Danio rerio


Alignment Length:315 Identity:79/315 - (25%)
Similarity:141/315 - (44%) Gaps:37/315 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLS 76
            |.:..|..|..:||:|.:...|..:|.::.::.||.|...|||:..:.     |.:|...|||.|
Zfish    14 NDRNTFSNGDTLAGRVIVEVSKQTKITSLTVQAKGKANVAWTETHGEE-----SVTYWDKEKYFS 73

  Fly    77 SKVYLLGSEISPE------MALEPGTRSYNFACPIP-INCPSSFEGTHGRIRYMVDVNIIQPWKY 134
            ..     ..:.||      :.|..|...:.||..:| .:.||||:|.||:|.|.:...:.:.::.
Zfish    74 QT-----QSVLPEDKADGSVTLVAGRHVFPFAFQLPNQSLPSSFKGVHGKIHYRLMAKLSRSFRA 133

  Fly   135 DSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPAN 199
            .|.....||.:...|.:|  |....|.....:|  .|..|.|..:::::.||:||:..|:.:..|
Zfish   134 ASKAEAKFTFVARADY
DT--STLTTPQHGSKDK--NVMFFASGNISMDIFLPKTGYQQGEGLIVN 194

  Fly   200 VLIGNESKIRVHEVKVGLSMMITY--YSDLSSGSKC-ERKSVAKLKADGVLRNSRKMYDFQLMIP 261
            ..|.|.|..::      :...|.|  .|..:.|.:. ....:.|.|.:.::.::|:.....|.:|
Zfish   195 GEIVNSSTRKI------VPKYIIYQKQSFFAGGQRAVHTTEILKEKGEPLVSSTRENLYKVLPLP 253

  Fly   262 STPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPI----SPSAVQ 312
            ....|..|.|||:|:.|:::|:..| ....|..:.:|..:  :|:    .|.|::
Zfish   254 PEISSTIHNCRILKVEYRLKVILDV-SFTKNPVIKLPFIV--LPLCNETPPKAIE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 40/145 (28%)
Arrestin_C 175..301 CDD:280848 30/128 (23%)
zgc:110353NP_001017785.1 Arrestin_N 6..149 CDD:304627 39/144 (27%)
Arrestin_C 171..293 CDD:280848 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579480
Domainoid 1 1.000 65 1.000 Domainoid score I10012
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.