DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrdc3b

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001004605.1 Gene:arrdc3b / 447866 ZFINID:ZDB-GENE-040912-182 Length:412 Species:Danio rerio


Alignment Length:392 Identity:99/392 - (25%)
Similarity:172/392 - (43%) Gaps:62/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVY 80
            ||.:|..|:|:|.:.....|:::::.:..||.|:..||||::..:|.:.:..:....:||:.:..
Zfish    23 VFASGDFVSGRVIVEVTGEIRVRSLNIHAKGLAKVRWTESRSAGSNTAYTRHFTEEVEYLNHRDV 87

  Fly    81 LLGSEISPE------MALEPGTRSYNFACPIPINCP--SSFEGTHGRIRYMVDVNIIQPWKYDSI 137
            |:..:...:      ..|..|...:.|:..:| ..|  :||||.||.:||.|...:.:.|.....
Zfish    88 LILHDRDDDCCDEAFTVLHSGRHEFPFSLELP-QTPLATSFEGKHGSVRYWVKAELHRQWLLPMK 151

  Fly   138 FSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLI 202
            ..:.|||.:.:||||...:|  |.....:||...|...|.|::|...:.:.|:.||:|:.....|
Zfish   152 TKKEFTVFEHIDIN
TPLLLS--PQAGTKDKTLCCWFCTSGPVSLSAKIERKGYTPGETIQIFAEI 214

  Fly   203 GNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKS-VAKLKADGVLRNSRKMYDFQLM-IPSTPP 265
            .|.|. ||...|..|....|::   :.|...|.|. :|.|:.|.:.....:.:|.::: ||...|
Zfish   215 ENCSS-RVVVPKAALYQTQTFF---AKGKVKEIKQLIANLRGDPLHSGKTETWDGKMLKIPPISP 275

  Fly   266 SCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSG----------P 320
            |... |.||.:.|.:.|...:. ..:|.||.:|:.|..:|:.....:.:..||.          |
Zfish   276 SILD-CSIIHVEYSLMVYVDIP-RAVNLTLNLPLVIGTIPLHSFGSRTSSVSSQCSMAMSWLGLP 338

  Fly   321 EAPEQRALTLIEGEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQ--SESGNAQEKSYKP 383
            |.||                            :||:|:|.:   :|.|:|  |:....:::...|
Zfish   339 ERPE----------------------------APPSYSEII---TDEERQCSSDLPAVRDEIEGP 372

  Fly   384 LY 385
            ||
Zfish   373 LY 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 37/142 (26%)
Arrestin_C 175..301 CDD:280848 35/127 (28%)
arrdc3bNP_001004605.1 Arrestin_N 22..165 CDD:278754 37/142 (26%)
Arrestin_C 188..311 CDD:280848 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.