DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Leash

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster


Alignment Length:395 Identity:104/395 - (26%)
Similarity:182/395 - (46%) Gaps:29/395 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTE-SKTDSNNKSTSES--YNGFEKYLSS 77
            |::||.::.|::.::.:|..:|:||::::.|..:..|.| .:.:|||...|.|  |...|.|..|
  Fly    16 VYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKNSNNNEYSRSLFYTSKEVYEHS 80

  Fly    78 KVYLLGSEISPE-MALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRA 141
            :..|  .:..|. :.|..|..::.|...:....||||:|::|.|:|.:.|.|.:||.:|...:..
  Fly    81 ETPL--PDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGAIKYKMRVLIQRPWTFDERHTIP 143

  Fly   142 FTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNES 206
            |||::.|.:..........::.:..||..:  |.:.|:||...||:...|.|:.:.....:.|.|
  Fly   144 FTVVKNMPL
QPMQRSIPSSLEKQVTKTISL--FGTRPITLLALLPEDFAVRGEPLRICATVINNS 206

  Fly   207 KIRVHEVKVGLSMMITYYSDLS-SGSKCERKSVAKLKADGVLRNSRKMYDFQLMIP-STPPSCFH 269
            ...|.:::..:...:||||.:. ...|.|..:||..:...|.:.:.:.:..:|::| ...|:...
  Fly   207 TTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSVQKKTERSFAHELLLPDGAQPTDEQ 271

  Fly   270 LCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPIS--PSAVQYTP---QSSGPEAPEQRALT 329
            :..:|.|.|::.|.|.::|...|..|.:|..:.....|  .|:::..|   .:.||..||.    
  Fly   272 MSGVITIVYELRVEAVLRGFFKNLILNLPFKVYSQDPSNRQSSLRPPPPPRPNDGPPGPEL---- 332

  Fly   330 LIEGEG-AFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQSESGNAQEKSYKPLYPVFDLSTS 393
               |.| .|.||.|.||..:.|..||      .||...||..|.:....:.|...|.|.....|.
  Fly   333 ---GSGNLFEPALPVYPSLDSSIGSP------SHSSQFSECSSINSITSDSSAATLSPAVGAGTG 388

  Fly   394 TVEKS 398
            .::.|
  Fly   389 GMDMS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 42/138 (30%)
Arrestin_C 175..301 CDD:280848 31/127 (24%)
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 42/137 (31%)
Arrestin_C 178..305 CDD:280848 31/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.