DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and CG2641

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_649737.1 Gene:CG2641 / 40921 FlyBaseID:FBgn0037518 Length:429 Species:Drosophila melanogaster


Alignment Length:382 Identity:103/382 - (26%)
Similarity:182/382 - (47%) Gaps:30/382 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKST---SESYNGFEKYLSS 77
            ::|:|:.|.|:..|:|.....:..:.:..:|.|:..|.|.:|.:....|   :|.:.|.::||.:
  Fly    15 IYYSGETVNGRAILTTTSEKSVNEVYILFEGEAKVRWDERRTRTRGGKTEHYTEYFRGKQQYLYT 79

  Fly    78 KVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAF 142
            :..:.||...|     |||.:|||..|:|:.||||....:|:|.|.|.|.|.:.|:::::|.:..
  Fly    80 RTSVFGSGNLP-----PGTHTYNFCIPLPLECPSSVVAQYGKIFYEVSVVIDRQWRFNNVFKQPL 139

  Fly   143 TVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNESK 207
            ||||..::|....: .:|:..:..|.|..||..|.|:...|.:|..|:.|||.:...:.|.|:|.
  Fly   140 TVIQTYNLN
MSPQL-LMPLVREDIKHFCCWPCSSGPVLSTLTIPFGGYAPGQKIRFTLEIDNQSS 203

  Fly   208 -IRVHEVKVGLSMMITYYSDLSSGSKCERK-SVAK-LKADGVLRNSRKMYDFQLMIPSTPPSCFH 269
             ..::.:::.|..:..:.:........|:: |:.| .:.:.|||.|:|..:..|.||:.|||. .
  Fly   204 GYDLNGIELKLKQIYKFQAQTPHHKTREKEHSLNKSCQQERVLRLSKKKIEGTLAIPAVPPSS-R 267

  Fly   270 LCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSG---PEAPEQRALTLI 331
            ...||.:.||:.:.......|::....:|:.|..:|:..||  ..|.|:.   ||.|:..|    
  Fly   268 TEGIISVSYQVILTISTGDCHVDSDFEVPIVIGTIPLIQSA--ENPASAAQWIPETPDTPA---- 326

  Fly   332 EGEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQSESGNAQEKSYKPLYPVF 388
               ||.|...|.|     ....||.:.||.:.........:..:.:...:.|.||::
  Fly   327 ---GAAADLPPSY-----DKCKPPTFEEATNFGERFIDIDQDEHNRTDDFIPRYPMY 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 43/137 (31%)
Arrestin_C 175..301 CDD:280848 32/128 (25%)
CG2641NP_649737.1 Arrestin_N 5..148 CDD:278754 43/137 (31%)
Arrestin_C 171..301 CDD:280848 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464075
Domainoid 1 1.000 94 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.