DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and CG10086

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster


Alignment Length:437 Identity:123/437 - (28%)
Similarity:211/437 - (48%) Gaps:62/437 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESK------TDSNNKS 63
            |.|.|..|..|.::.||::.|:|.::.:|..:::.|:|::.|||:..|...:      ..:..|.
  Fly     5 CMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKR 69

  Fly    64 TSESYNGFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNI 128
            :...|:|.|.|::|..||:|||......::.||.:|.||||||.:|||||||.:|.|||:..|..
  Fly    70 SKHQYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVTF 134

  Fly   129 IQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPG 193
            ::|...:...:..|||::::|:|....:.:.|...:..:.|.:  ..:.|:.|::.|.|.|:|||
  Fly   135 LKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCL--MHTKPVQLKVTLQQQGYVPG 197

  Fly   194 QTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSS-GSKCERKSVAKLKADGVLRNSRKMYDFQ 257
            |.:..:..:.|:|.....::.:.|.:..||.:|..| .:..|:..:.|.:...|..|:::.|...
  Fly   198 QFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRECGPVAHNAQRTYTET 262

  Fly   258 LMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISP--SAVQYTPQS--- 317
            |.||:|.|:|.||.:::::.|::.|||.:..:..|..||:||||..||::.  |...:.|.:   
  Fly   263 LRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATAVSGPDFLPTNAFP 327

  Fly   318 SGPEAP------EQRALTL-------------------------------IEGEGAFAPAAPPYP 345
            ||...|      ..||:.|                               :|....|.|..|   
  Fly   328 SGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLEDFELPEDGDDELEAADDFVPDLP--- 389

  Fly   346 WSEGSTLSPPNYAEAMHSHSDSEKQSESGNAQEKSYKPLYPVFDLST 392
                    ||.|.:||...:|......:..::...:.|.|||||:.|
  Fly   390 --------PPTYEQAMFMTTDIADTDANTVSEASRFTPRYPVFDVDT 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 53/151 (35%)
Arrestin_C 175..301 CDD:280848 38/126 (30%)
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 53/151 (35%)
Arrestin_C 179..308 CDD:280848 40/128 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464041
Domainoid 1 1.000 139 1.000 Domainoid score I9790
eggNOG 1 0.900 - - E1_KOG3780
Homologene 1 1.000 - - H119234
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
1110.900

Return to query results.
Submit another query.