DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Vdup1

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001163303.1 Gene:Vdup1 / 38023 FlyBaseID:FBgn0035103 Length:342 Species:Drosophila melanogaster


Alignment Length:310 Identity:70/310 - (22%)
Similarity:134/310 - (43%) Gaps:23/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGF 71
            ::..:||..:::.||.::|:|.:..........:...:.|.....        |.:....:|:. 
  Fly     9 LIIFDNTSLLYFPGQFLSGRVLIELQDETPALGLHFHVVGEGVVR--------NGRRQERTYDK- 64

  Fly    72 EKYLSSKVYLLG--SEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKY 134
            |.|:..::.|||  .:..|.: |.||..|:.|...:|:..||:|.|.:|.|::.....:.:   .
  Fly    65 ENYIDFRMRLLGDVDQGGPAI-LSPGIHSFPFKLGLPLGLPSTFLGRYGWIQFYCKAALRE---N 125

  Fly   135 DSIFSR---AFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTV 196
            :.|..:   .|.|:..:|:|....:...|...:.|...||.......:...::|.:.|:|||:.:
  Fly   126 NGIIHKNHQVFIVMNPIDLN
LEKPILAQPFTCEVEHKLGVVCVGGGQIKCRVSLDRGGYVPGENI 190

  Fly   197 PANVLIGNESKIRVHEVKVGLSMMITYYSDLSSGS--KCERKSVAKLKADGVLRNSRKMYDFQLM 259
            .....|.|.|.:.:...|..|:..|.|   |:.|.  :.|::.:|.|....:...::..:..:|.
  Fly   191 LVTAFISNYSNVSIKRTKASLTETIEY---LARGKVVQTEKRELAVLVRGKIRPGAKDEWHNELY 252

  Fly   260 IPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPS 309
            :|..||:..|.|.:|||.|.:..|.:.|.|.....|.:|:.:...|...|
  Fly   253 VPPLPPTNLHGCHLIKISYDVFFVIEPKSMEKEIKLQLPIVLATYPFRHS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 31/148 (21%)
Arrestin_C 175..301 CDD:280848 32/127 (25%)
Vdup1NP_001163303.1 Arrestin_N 8..145 CDD:304627 31/148 (21%)
Arrestin_C 171..299 CDD:214976 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10262
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24518
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.