DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and txnipa

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_956381.1 Gene:txnipa / 368359 ZFINID:ZDB-GENE-030804-10 Length:400 Species:Danio rerio


Alignment Length:367 Identity:72/367 - (19%)
Similarity:153/367 - (41%) Gaps:44/367 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESY 68
            :.:|.|::.::..:.:|..|||:|.:...:..::.|:::...|.|:..:.:.|.....:   ..|
Zfish    10 VFEIAFNDPSKTFYCSGDKVAGKVLVEVSEVTRVMAMKVLGVGCAKVEYAKGKQRCREE---VDY 71

  Fly    69 NGFEKYLSSKVYLLGSEISPEMALEPGTR---SYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQ 130
            ..:|..:....:...::.|  :.|.||.:   |:.|..|......||::|..|.::|.|...:.:
Zfish    72 LKYEDVVQLDEHPTDNDGS--VILRPGNKYEYSFGFELPAQGQLVSSYKGKFGFVQYYVKALMER 134

  Fly   131 PWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQT 195
            |.:......:.|.|.:.:|:||.:.:|  |.....||...........::|...:.:.||..|:.
Zfish   135 PCQPALECKKHFEVEEPLDVNTPDLLS--PTGGMKEKKVTCMFIPDGQVSLNAKIDRRGFCEGEE 197

  Fly   196 VPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDF---- 256
            :..:....|... |:...|..:....||.:  :..:|..|:.::.::.:.::..   |.|.    
Zfish   198 ICIDAKFENTCS-RIVVPKAAIVAKQTYQA--NGRTKVFRQKLSSVRGNHIISG---MCDAWQGK 256

  Fly   257 QLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGT----LIMPVTICGVPISPSAVQYTPQS 317
            .:.:|...||... |.||::.|.:.:.     |||.|:    |.:|:.|..||.:....:....|
Zfish   257 SIRVPKIKPSILG-CNIIRVEYALMIY-----MHIPGSEKLILELPLVIGTVPYNGFGSRTNSMS 315

  Fly   318 SGPEAPEQRALTLIEGEGAFAPAAPPYPWSEGSTLSPPNYAE 359
            |              .:|:.:.|:..:......:.:||:|.:
Zfish   316 S--------------QDGSISNASNSWVSLRMPSSAPPSYCD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 30/148 (20%)
Arrestin_C 175..301 CDD:280848 26/133 (20%)
txnipaNP_956381.1 Arrestin_N 11..155 CDD:304627 30/148 (20%)
Arrestin_C 178..304 CDD:214976 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10012
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.