DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Arrdc1

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_038961502.1 Gene:Arrdc1 / 366001 RGDID:1309961 Length:466 Species:Rattus norvegicus


Alignment Length:419 Identity:93/419 - (22%)
Similarity:169/419 - (40%) Gaps:81/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TQG--VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYL 75
            :||  |:..|:.:||.|.|.....:..:|||:...|         ....:||:...::...|.|.
  Rat    12 SQGRVVYSPGEPLAGAVHLRLGAPLPFRAIRVTCMG---------SCGVSNKANDGAWVVEESYF 67

  Fly    76 SSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQP-WKYDSIFS 139
            :|.:     .::.:.:|.||..::.|...:|...|:||||..|:|.:.|..:|..| :..|...|
  Rat    68 NSSL-----SLADKGSLPPGEHNFPFQFLLPATAPTSFEGPFGKIVHQVRASIDTPRFSKDHKCS 127

  Fly   140 RAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGN 204
            ..|.::..:::|:...:.| |..|.|.|.|.....::..:.|..:....|:|.||.:.....|.|
  Rat   128 LVFYILSPLNLN
SIPDIEQ-PNVASTTKKFSYKLVKTGSVVLTASTDLRGYVVGQVLRLQADIEN 191

  Fly   205 ESKIRVHEVKVGLSMM--------ITYYSDLSSGS----------------KCER-----KSVAK 240
            :|......|...|..:        :.:..|...|.                |.:|     :::|:
  Rat   192 QSGKDTSPVVASLLQVRAIWFPEPVPFPWDRRGGCQPAQTHSPVFPQKVSYKAKRWIYDVRTIAE 256

  Fly   241 LKADGVLRNSRKMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVP 305
            ::..||.......:..|:::|:.|.|....|.:|.|.|.::|..|..    ..|:.:|:.:..: 
  Rat   257 VEGTGVKAWRHAQWQEQILVPALPQSALPGCSLIHIDYYLQVSMKAP----EATVTLPLFVGNI- 316

  Fly   306 ISPSAVQYTPQSSGPEAPEQRALTLIEGEGA-------FAPAAPPYPWSEGSTLSPPNYAE---- 359
                ||..||.|..|            |.|:       ..|:|||...:| :..|.|::::    
  Rat   317 ----AVNQTPLSPCP------------GPGSSPGLLSPVVPSAPPQEEAE-AVASGPHFSDPVSL 364

  Fly   360 AMHSHSDSEKQSES-GNAQEKSYKPLYPV 387
            :..|||..:..|.: |:....:.:|...|
  Rat   365 STKSHSQQQPLSTTLGSVSVTTIEPCVQV 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 35/140 (25%)
Arrestin_C 175..301 CDD:280848 29/154 (19%)
Arrdc1XP_038961502.1 Arrestin_N 7..139 CDD:419887 35/140 (25%)
Arrestin_C 162..316 CDD:214976 29/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.