DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Arrdc2

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001100773.2 Gene:Arrdc2 / 306344 RGDID:1309659 Length:407 Species:Rattus norvegicus


Alignment Length:394 Identity:104/394 - (26%)
Similarity:177/394 - (44%) Gaps:47/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSS 77
            |:.||:.||.|||:|.|....|.::.|:||:.:|.|..|||||::..::.:.::||:...:.::.
  Rat    20 TEPVFHGGQAVAGRVLLELAGAARVGALRLRARGRARAHWTESRSAGSSTAYTQSYSERVEVVNH 84

  Fly    78 KVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAF 142
            :..||..:....:.|..|...:.|:..:||:..:||||.||.:||.:...:.:||.......:.|
  Rat    85 RATLLAPDSGDIVMLPAGRHEFPFSFQLPISLVTSFEGKHGSVRYSIKATLHRPWVPARRARKVF 149

  Fly   143 TVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNESK 207
            |||:.:||||...:.  |.....||....|......::|...:.:.|:.||:.:|....|.|.| 
  Rat   150 TVIEPVDINTPALLE--PQAGAREKVARSWYCTRGLVSLSAKIDRKGYTPGEVIPIFAEIDNGS- 211

  Fly   208 IRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDFQ-LMIPSTPPSCFHLC 271
            .|..:.:..|....|:.:..:...||  ..||.:..:.|....|.::..: |.||...||..| |
  Rat   212 TRAVQPRAALVQTQTFMARGARKQKC--AVVASVDGEPVGPGRRALWPGRALRIPPVGPSILH-C 273

  Fly   272 RIIKIGYQIEVVAKVKGMHINGTLI--MPVTICGVPISPSAVQYTPQSS---------------G 319
            |::.:.|.::|...:.|   :..|:  :|:.|..||:.|...:.....|               .
  Rat   274 RVLSVDYSLKVCVDIPG---SSKLLLELPLVIGTVPLHPLGSRSASVGSRASFLQDWGLCALMER 335

  Fly   320 PEAPEQRALTLIE------GEGAFAPAAPPYPWSEGSTLS---------PPNYAEAMHSHSDSEK 369
            ||||.:.:..:.|      .:|.|:....|...:||...:         ||.|:|     .|...
  Rat   336 PEAPPEYSEVVRESPQVAASQGLFSFLHDPDVTTEGPYFACLQEFRYRPPPLYSE-----EDPNP 395

  Fly   370 QSES 373
            .||:
  Rat   396 PSEA 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 45/137 (33%)
Arrestin_C 175..301 CDD:280848 30/128 (23%)
Arrdc2NP_001100773.2 Arrestin_C 180..307 CDD:214976 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7129
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8998
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.