DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Arrdc4

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001380690.1 Gene:Arrdc4 / 293019 RGDID:1311763 Length:415 Species:Rattus norvegicus


Alignment Length:419 Identity:108/419 - (25%)
Similarity:182/419 - (43%) Gaps:77/419 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESK------TDSNNKSTS 65
            ::|.:.::|.:.:|:.|||.|.|...:.:.::.:||:.:|.|.:.|..|.      ..::..::|
  Rat    19 LVFEDESKGCYSSGETVAGHVLLEAAEPVTLRGLRLEAQGRATSAWGPSAGARVCIGGASPAASS 83

  Fly    66 ESYNGFEKYLSSKVYLLGSEISPEMA-LEPGTRSYNFACPIPIN-CPSSFEGTHGRIRYMVDVNI 128
            |     .:||:.::.||.:.....:. |:||...:.|...:|.. ..:||.|.:|.|:|.|...:
  Rat    84 E-----VEYLNLRLSLLEAPAGEGVTLLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVL 143

  Fly   129 IQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPG 193
            .:|...|....|...|:..:|:||...::  |:....||..|.|.|.|.|::|.:.:.:.|:..|
  Rat   144 ERPQVPDQSVRRELQVVSHVDVNTPPLLT--PMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNG 206

  Fly   194 QTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMYDFQ 257
            :.:|....|.|.|. |:...|..:....||   |:|| :|..|..||.::.:.:...|...::.:
  Rat   207 EAIPIYAEIENCSS-RLVVPKAAIFQTQTY---LASGKTKTVRHMVANVRGNHIGSGSTDTWNGK 267

  Fly   258 LM-IPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGT----LIMPVTICGVPI-------SPSA 310
            :: ||...||....| ||::.|.:.|.     :||.|.    |.:|:.|..:|.       |..|
  Rat   268 MLKIPPVTPSILDCC-IIRVDYSLAVY-----IHIPGAKKLMLELPLVIGTIPYSGFGRRNSSMA 326

  Fly   311 VQYT----------PQSSGPEAPEQRALTLIEGEGAFAPAAPPYPW----------------SEG 349
            .|::          |:.  ||||...|..:.|.|  |:...||||.                .|.
  Rat   327 SQFSMDMCWLALALPEQ--PEAPPNYADVVSEEE--FSRHIPPYPQPSACDGEACYSMFACIQEF 387

  Fly   350 STLSPPNYAEAMHSHSDSEKQSESGNAQE 378
            ....||.|         ||.....|:|||
  Rat   388 RFQPPPLY---------SEVDPHPGDAQE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 37/151 (25%)
Arrestin_C 175..301 CDD:280848 35/131 (27%)
Arrdc4NP_001380690.1 Arrestin_N 19..166 CDD:395268 37/151 (25%)
Arrestin_C 188..315 CDD:214976 36/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm12328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.