DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and ZK938.11

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:96 Identity:21/96 - (21%)
Similarity:44/96 - (45%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FEKYLS-SKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKY 134
            :|.|.. |.:.....:...::.:|...:|:.|  .||.....:::.  |.|:|.:.:.:.:|||.
 Worm    10 YETYFKRSAIVWTSKDGKNKLPVELLEKSFEF--QIPTGSRLTYKA--GHIKYTMSLEVDRPWKT 70

  Fly   135 DSIFSRAFTVIQVMDIN----TYN-SVSQVP 160
            :....:...|.:.:|::    |.| :||..|
 Worm    71 NLKVKKEVIVARKLDVDEVYFTENKTVSNKP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 16/80 (20%)
Arrestin_C 175..301 CDD:280848
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:389964 15/78 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.