DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and ARRDC2

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_056498.1 Gene:ARRDC2 / 27106 HGNCID:25225 Length:407 Species:Homo sapiens


Alignment Length:394 Identity:103/394 - (26%)
Similarity:176/394 - (44%) Gaps:52/394 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVY 80
            ||..||.|||:|.|....|.::.|:||:.:|.|..|||||::..::.:.::||:...:.:|.:..
Human    23 VFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWTESRSAGSSTAYTQSYSERVEVVSHRAT 87

  Fly    81 LLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTVI 145
            ||..:......|.||...:.|:..:|....:||||.||.:||.:...:.:||.......:.||||
Human    88 LLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWVPARRARKVFTVI 152

  Fly   146 QVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNESKIRV 210
            :.:||||  .....|.....||....|......::|...:.:.|:.||:.:|....|.|.|...|
Human   153 EPVDIN
T--PALLAPQAGAREKVARSWYCNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNGSTRPV 215

  Fly   211 HEVKVGLSMMITYYSDLSSGSKCERKS-VAKLKADGVLRNSRKMYDFQ-LMIPSTPPSCFHLCRI 273
                :..:.::...:.::.|::.:::: ||.|..:.|....|.::..: |.||...||..| ||:
Human   216 ----LPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILH-CRV 275

  Fly   274 IKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSG------------------- 319
            :.:.|.::|...:.|.. ...|.:|:.|..:|:.|    :..:||.                   
Human   276 LHVDYALKVCVDIPGTS-KLLLELPLVIGTIPLHP----FGSRSSSVGSHASFLLDWRLGALPER 335

  Fly   320 PEAPEQRALTLIEGEGAFAPAAP-PYPWSEGSTLSPPNYAEAMHSHSDSEKQSESGNAQEKSYK- 382
            ||||.:.:..:.:.|.|....:| |.|.....:|..|.:|                ..||..|: 
Human   336 PEAPPEYSEVVADTEEAALGQSPFPLPQDPDMSLEGPFFA----------------YIQEFRYRP 384

  Fly   383 -PLY 385
             |||
Human   385 PPLY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 45/134 (34%)
Arrestin_C 175..301 CDD:280848 28/127 (22%)
ARRDC2NP_056498.1 Arrestin_N 9..158 CDD:278754 45/134 (34%)
Arrestin_C 181..307 CDD:214976 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7402
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8525
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.