DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and SPAC1F12.05

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_594331.1 Gene:SPAC1F12.05 / 2542260 PomBaseID:SPAC1F12.05 Length:377 Species:Schizosaccharomyces pombe


Alignment Length:141 Identity:34/141 - (24%)
Similarity:53/141 - (37%) Gaps:45/141 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KTDSNNKSTSESYNGFEK-YLSSKVYLLGSEISPEMALEPGTRSYNFACPI-------PINCPSS 112
            |...|..||   :.|.:| |:..:..|||:........|.|.|.. |..||       || |..|
pombe   222 KAQINGCST---HTGTKKPYIFKETRLLGNNEHKSGWKEDGDRII-FEIPISTSLLSKPI-CDVS 281

  Fly   113 FEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSD 177
            |:|...  .|:....|::.           .|::||:.:..||.:::                  
pombe   282 FDGQFS--LYIAHQLILET-----------IVVEVMNSHPINSNARI------------------ 315

  Fly   178 PLTLELNLPQT 188
             |.:::|||.|
pombe   316 -LRMKVNLPLT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 27/102 (26%)
Arrestin_C 175..301 CDD:280848 5/14 (36%)
SPAC1F12.05NP_594331.1 LDB19 63..231 CDD:193475 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.