DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and SPBC2D10.04

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_596223.1 Gene:SPBC2D10.04 / 2540410 PomBaseID:SPBC2D10.04 Length:658 Species:Schizosaccharomyces pombe


Alignment Length:475 Identity:87/475 - (18%)
Similarity:154/475 - (32%) Gaps:148/475 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTES------KTDSNNKSTSESYNGFE-------- 72
            ::.|.:.|...|...|:.|.|...|.:.|.|.|.      .|..:....|.::..:|        
pombe   175 LLRGALVLRVAKPANIRGISLSFTGRSRTEWPEGIPVKGHDTYEDKVIISHNWKFYEPTMKDADA 239

  Fly    73 -KYLSSKVYLLGSEIS-PEMA---------LEPGTRSYNFACPIPINC-PSSFEGTHGRIRYMVD 125
             ::.:....|:|.::. |..|         ..||..:|||...|| || |.|.|...|.:||.::
pombe   240 PQHGADVARLVGEQLPLPSSAAASLRGYSVFAPGEYTYNFDLAIP-NCFPESVEAKMGWVRYFLE 303

  Fly   126 VNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQV----PVQAKTEKTFGV---WPFRSDPLTLEL 183
            ..:.:...:.|            ::|....|..|    |....:.:...:   |..|   |..||
pombe   304 ATVERFGTFKS------------NLNGRTPVQLVRTPSPASLSSSELINISRDWDER---LHYEL 353

  Fly   184 NLPQTGFVPGQTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKL------- 241
            .:....|..|:.||.........|:|::::.:.:.....|:.......:.:.|....|       
pombe   354 QVSGKSFRLGEVVPITFRFLLLDKVRLYKLSISVVESSEYWCRSRKFHRVDPKRRVLLAERSAKH 418

  Fly   242 -----------KADGVLRNSRKMYDFQLMIPSTPPSCFHLC--------------RIIKIGYQIE 281
                       :.||:   |..:::|.:.:|:        |              :.||:.::::
pombe   419 QNTDNLFETPDEGDGL---SSAVFNFNVALPT--------CLVKERDRLTFDTTYKYIKVRHRLK 472

  Fly   282 VV-----------AKVKGMHIN---------------GTLI----------------MPVTICGV 304
            .:           .|.|...||               .||:                .|..:...
pombe   473 ALLVLSIENTENPEKRKYFEINIETPVRILSCRCVKDSTLLPPYESSSQGDNQVLLPCPCRLATT 537

  Fly   305 PISPSAV-QYTPQ----SSGPEAPEQRALTLIEGEGAF-APAAPPYPWS-----EGSTLSPPNYA 358
            .:.|:.| .:|.|    ||.|.|....|..:......| .|:..|.|:.     ......||||.
pombe   538 HVEPTEVTAFTTQSVLASSAPSAGRPAAAQISRPAQLFRIPSTNPPPFDGDVCPPACNTPPPNYD 602

  Fly   359 E---AMHSHSDSEKQSESGN 375
            |   .:.|.|..:.:::..|
pombe   603 ELFDVLSSISIQDCETDRAN 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 33/154 (21%)
Arrestin_C 175..301 CDD:280848 28/199 (14%)
SPBC2D10.04NP_596223.1 Arrestin_N 178..308 CDD:304627 32/130 (25%)
Arrestin_C 345..506 CDD:214976 26/174 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.