DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and rnh-1.2

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496121.2 Gene:rnh-1.2 / 191471 WormBaseID:WBGene00014163 Length:192 Species:Caenorhabditis elegans


Alignment Length:42 Identity:10/42 - (23%)
Similarity:21/42 - (50%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LKGYAETHWTESKTDS-NNKSTSESYNGFEKYLSSKVYLLGS 84
            :||: .|::...:.|. ..|:...:.|.:.:||.:|..:..|
 Worm   146 VKGH-HTNFFNCEADRLAKKACRSNINQYNRYLKNKSNMYAS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 10/42 (24%)
Arrestin_C 175..301 CDD:280848
rnh-1.2NP_496121.2 RNase_H_like 8..167 CDD:387386 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.