DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-5

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496119.1 Gene:arrd-5 / 191469 WormBaseID:WBGene00014161 Length:378 Species:Caenorhabditis elegans


Alignment Length:374 Identity:86/374 - (22%)
Similarity:162/374 - (43%) Gaps:50/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLS-TDKAIQIKAIRLKLKGYAETHWTESKTDSNNK----------STSESYN 69
            ||..|:.|.|.|.:: .|...:.:.:|:::.|.|.|:|..:..:::.|          .....:.
 Worm    14 VFSPGEKVTGNVKMTIPDDEFKARKVRMEMIGKAYTYWEGNVRNNHTKIKNGDIARVRHNCADHK 78

  Fly    70 GFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKY 134
            |...|...:..:..|: ..:..:..|...:.|:..:|...|.||||..|.|||.:.|.|.:|||:
 Worm    79 GKIVYCRFETIVWKSD-GAKNDMPSGPHIFPFSFQLPHWAPPSFEGDLGFIRYFIKVEIDRPWKF 142

  Fly   135 DSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPAN 199
            |..|....||:..:|:....: ||||.:....:.||...:::..:.:||.||:.|||.|:.:|..
 Worm   143 DDKFITCLTVLPNIDL
RLIPN-SQVPSKKHVCEEFGAVLWKNGLVRMELRLPKQGFVCGENIPVT 206

  Fly   200 VLIGNESKIRVHEVKVGLSMMITY--YSD-----------------------LSSGSKCERKSVA 239
            :::.|::.....::.:.|...:||  :.|                       |::.::.|.:.::
 Worm   207 MIVDNKTSKSFKKISLRLVQRVTYTGFRDGFVNSHSQPCIGNEKEKITYATRLNAQTRVEERQIS 271

  Fly   240 KLKAD-GVLRNSRKMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICG 303
            :...| .:.:|.::..:..:.:|..|||. ..|.||.:.|.::|.....|...:...:....|.|
 Worm   272 ETNIDIKIDKNEKQEVEKPIPLPPLPPST-KTCEIIDVEYFLKVKMSTSGALKSAVKLELAFIIG 335

  Fly   304 -VPISPS-AVQYTPQSSGPEAPEQRALTLIEGEGA--FAPAAPPYPWSE 348
             :||.|. ..:|.....|      .|.|.::....  |||..|.:.:.|
 Worm   336 TMPIDPERKYEYKKSVFG------FAATSLKNRDVQKFAPLYPVFKFDE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 38/145 (26%)
Arrestin_C 175..301 CDD:280848 28/151 (19%)
arrd-5NP_496119.1 Arrestin_N 4..158 CDD:334019 37/144 (26%)
Arrestin_C 182..338 CDD:214976 30/156 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46400
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm14113
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.