DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-15

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001254970.1 Gene:arrd-15 / 191372 WormBaseID:WBGene00014033 Length:374 Species:Caenorhabditis elegans


Alignment Length:343 Identity:85/343 - (24%)
Similarity:146/343 - (42%) Gaps:52/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGQMVAGQVTL-STDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVYLL 82
            ||:....:|.| |:|....:.:...::||...|.|....||       :.:...:.|:.::|.|.
 Worm    49 AGEFFNAKVLLDSSDPDTVVHSFCAEIKGIGRTGWVNIHTD-------KIFETEKTYIDTQVQLC 106

  Fly    83 GSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDS--------IFS 139
            .|    ...|..|...:.....||:|||||:|...|.|||.:.|.:.......|        |.:
 Worm   107 DS----GTCLPVGKHQFPVQIRIPLNCPSSYESQFGSIRYQMKVELRASTDQASCSEVFPLVILT 167

  Fly   140 RAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGN 204
            |:|     .|....|::|.:..:.:.:.|....||..  ::|.::|.:|.|..|:::.|.|.|.|
 Worm   168 RSF-----FDDVPLNAMSPIDFKDEVDFTCCTLPFGC--VSLNMSLTRTAFRIGESIEAVVTINN 225

  Fly   205 ESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKAD----GVLRNSRKMYDFQ---LMIPS 262
            .::..:.||.:.| :|.|.:...|.......|.:|:...:    |.:: ||...:|:   |.||.
 Worm   226 RTRKGLKEVALQL-IMKTQFEARSRYEHVNEKKLAEQLIEMVPLGAVK-SRCRMEFEKCLLRIPD 288

  Fly   263 TPPSCFHLCR------IIKIGYQIEVVAKVKGMHINGTLIMPVTICGV--PISPSAVQY-----T 314
            ..|...:..|      ||.|.|.:::.| :.|:.....||  ||.||.  |...:|.|:     .
 Worm   289 AAPPTQNYNRGAGESSIIAIHYVLKLTA-LPGIECEIPLI--VTSCGYMDPHKQAAFQHHLNRSK 350

  Fly   315 PQSSGPEAPEQRALTLIE 332
            .:.|..|..:::...::|
 Worm   351 AKVSKTEQQQRKTRNIVE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 36/140 (26%)
Arrestin_C 175..301 CDD:280848 35/138 (25%)
arrd-15NP_001254970.1 Arrestin_N 49..148 CDD:304627 31/109 (28%)
Arrestin_C 198..330 CDD:280848 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.