DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-16

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_499629.2 Gene:arrd-16 / 190071 WormBaseID:WBGene00013043 Length:399 Species:Caenorhabditis elegans


Alignment Length:395 Identity:98/395 - (24%)
Similarity:165/395 - (41%) Gaps:55/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FH-----NNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHW--TESKTDSNNKSTSE 66
            ||     :|.:.::..|..:.|.||....:::::||||:..:|.|.|.|  :||...|:.:|...
 Worm     3 FHLALGLSNCEQIYEPGGTIEGYVTFDLRESVKVKAIRISAEGLATTKWLLSESSKSSHGRSREV 67

  Fly    67 SYNGFEKYL-SSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQ 130
            ||:....|| ..::....||...:.::.||...|.|...|||..|.||||.||.|||.:...:.:
 Worm    68 SYSAKVTYLDEEQMVWKPSEGHSKSSVFPGIHVYPFKFQIPIGVPPSFEGDHGNIRYHMKATVER 132

  Fly   131 PWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQT 195
            |||.:...:|..|::...|:|.....|:.....|::|. |.:.||...:.|::.:|:.|:|||:|
 Worm   133 PWKTNRSVTRYLTILPPKDLNKEVLASEETSSWKSKKV-GFFLFRYGKVNLQIRIPKKGYVPGET 196

  Fly   196 VPANVLIGNESKIRVHEVKVGLSMMITYY---------------SDLSSGSKCERKSVAKLKADG 245
            :.....|.|.|...:.:.:..|.....:.               |.||...:...:...::|...
 Worm   197 ISIETNIDNMSSRPILKTECYLIQQCRFLAYRYGISGPTDGRRASSLSENDRYLSRKRDEIKIVS 261

  Fly   246 VL-------RNSRKMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTL--IMPVTI 301
            |:       |...|. ..:|.||.|.|: |. ..:|.:.|.:.|...|| ..:..|:  ..|:.|
 Worm   262 VIHEMHIEPRTEHKA-KMRLKIPCTCPT-FD-STLIHVEYFVVVKLHVK-CRMRNTVKAECPIII 322

  Fly   302 CGVPISPSAVQYTPQSSGPEAPEQRALTLIEGEGAFAPAAPPYPWSEGSTLSP-----PNYAEAM 361
            ...|::...|.       |..|..:.:      ..|:........|....|:|     |.|.::.
 Worm   323 GSKPLADEHVD-------PRTPTYQEV------ATFSALTHRSMMSVDEKLTPKYVYYPKYGKSR 374

  Fly   362 HSHSD 366
            ...:|
 Worm   375 DDEAD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 48/149 (32%)
Arrestin_C 175..301 CDD:280848 32/149 (21%)
arrd-16NP_499629.2 Arrestin_N 9..153 CDD:334019 46/143 (32%)
Arrestin_C 178..327 CDD:214976 32/152 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm14113
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.