DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-22

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_503955.1 Gene:arrd-22 / 188642 WormBaseID:WBGene00020612 Length:456 Species:Caenorhabditis elegans


Alignment Length:462 Identity:117/462 - (25%)
Similarity:196/462 - (42%) Gaps:100/462 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTS--- 65
            :.|::| :....||..||.::|:|.|:|.|.:..:|:.:|:.|.|.|.|   |...|:...|   
 Worm     6 LLQVIF-DQPDEVFLPGQPISGRVVLTTKKKLSARAVNIKIVGLAHTSW---KNYENSCKLSFHR 66

  Fly    66 -ESYNGFEKYLSSKV-YLLGSEI------SPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRY 122
             .||.....|.|:.| ||..:::      .|: .|..|..::.|:..:|:|.|.||||.:|.:||
 Worm    67 IVSYRPHGVYYSANVKYLDYTQLLWTCGEGPK-ELNAGEYAWPFSYTLPLNIPPSFEGKYGYLRY 130

  Fly   123 MVDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQ 187
            .|.|.:.:||:.|.......||..::|:|.... |..|:..:..:..|...|::..|.:.:|:|:
 Worm   131 TVKVEVDRPWRVDKAKKMCITVSPLLDLNVIPH-SLTPINTQASENLGCCCFKNGFLEMNVNIPK 194

  Fly   188 TGFVPGQTVPANVLIGNES-----KIRVHEVKVGLSMMITYYSDLSS----GSKCERKSVAKLKA 243
            ||||||:|||.|:.:.|.|     ||   |.|:......|.|.|.::    |.:...:...::..
 Worm   195 TGFVPGETVPLNIHLINHSSSTAKKI---EAKILQQCKFTGYKDGATYNYGGDENMSEKAQRIMF 256

  Fly   244 D--GVLRNSRKM---------YDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGM-HINGTLI 296
            |  .|:|.|:|:         :..:|.|||..|:......::.:.|.|::......| |......
 Worm   257 DTKTVVRESQKLVVAAKNEHKFVLELRIPSVTPTINQFSPVVTVEYLIQLKVDTSAMSHSEVRCE 321

  Fly   297 MPVTICGVPI----SPSAVQYTP----------------------------QSSGPEAPEQRAL- 328
            ..:.:..|||    .||..|..|                            ...|.:||....| 
 Worm   322 TSILLGSVPIRQCLPPSYYQQDPSVLPSKPTPIGEGVAPPPGYGSLPMTDDSEKGTDAPYPLGLY 386

  Fly   329 -----------TLIEGEGAFAPAAPPYPWSEGSTLSPPNYAEAMHSHSDSEKQSESGNAQEKSYK 382
                       ::::...|..|:||           ||:|.|:|:....:...::    :.:.|.
 Worm   387 PNVNDVNLPYPSVVQDGNAVIPSAP-----------PPSYQESMYGKGGTVLDAK----ENEPYV 436

  Fly   383 PLYPVFD 389
            |.||||:
 Worm   437 PKYPVFN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 49/156 (31%)
Arrestin_C 175..301 CDD:280848 37/146 (25%)
arrd-22NP_503955.1 Arrestin_N 7..159 CDD:334019 49/156 (31%)
Arrestin_C 182..330 CDD:214976 37/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46400
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm14113
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.