DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-23

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_508830.3 Gene:arrd-23 / 188239 WormBaseID:WBGene00020323 Length:444 Species:Caenorhabditis elegans


Alignment Length:439 Identity:87/439 - (19%)
Similarity:152/439 - (34%) Gaps:110/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQMVAGQVTLS-TDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVYLLG 83
            |..:.|::.|. ::.:|:|.::|:...||.:.: .:.|.|...:........|...:|..:.:..
 Worm    30 GDTIQGKLNLKISEGSIEITSLRILFHGYGKIN-CKGKKDELLQENMTYMKKFSNAISQPIVVSQ 93

  Fly    84 SEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFS--------R 140
            .|.|  :.:|.         .:|...|:|.....|.|:|::...:    :|.:...        |
 Worm    94 QEYS--IPIEE---------TLPDQLPTSVYSPKGHIQYVIQCTL----EYKTAAGTPSIVKAVR 143

  Fly   141 AFTVIQVMDINTYNSVSQVPVQAKTE---KTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLI 202
            ..|||:.:|:   |.:|:...:.|||   :.||.:......:.|.|...::.||.|:.:|....|
 Worm   144 GITVIESLDL---NKISKTWFEPKTEFEQRKFGWFACTGGHIRLHLTFERSAFVCGEAIPFIGKI 205

  Fly   203 GNESKIRVHEVKVGLSMMITYYSDLSSGSK--------CERKSVAKLKADGVLRNSRKMYDFQLM 259
            .|:|..|:.:|.|.|.....:.:|:....:        .:...:|....:|.:....|.......
 Worm   206 ENKSDRRIEKVSVCLMRNTRFGNDVEDDVENATVDHHLIQEDLMAMYIEEGCVNKIDKKVHIPCT 270

  Fly   260 IPSTP-PSCF------------------------------------HLCRIIKIGYQIEVVAKVK 287
            .|||| |..|                                    ::.||:.|.|...:..:..
 Worm   271 APSTPLPILFRSGQLDGNKFQLRRKSQLGRLSLTSQKSRQSISSTSNMQRILAITYAFLIKVRSN 335

  Fly   288 GMHINGTLIMPVTICGVPISPSAVQYTPQSSGPEAPEQR-ALTLIEGEGAFAPAAPPYPWSEGST 351
            ||.:. .|.:||.|..||.....     .|..|..|..| .:.|...:       .|.|..:...
 Worm   336 GMDVI-DLSVPVVIGTVPYIDHV-----NSGDPSDPLDRPVINLCRQD-------KPIPLLDEKE 387

  Fly   352 LSPPNYAEAMHSHSDSEKQSESGNAQEKSYKPLYPVF-DLSTSTVEKSK 399
            .|..|.|:..|.:.                   ||.| .|.||:.:..|
 Worm   388 RSLCNKAQLQHVNK-------------------YPFFATLPTSSKQSKK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 27/139 (19%)
Arrestin_C 175..301 CDD:280848 32/170 (19%)
arrd-23NP_508830.3 Arrestin_C 180..353 CDD:214976 34/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.