DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-12

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001309576.1 Gene:arrd-12 / 187636 WormBaseID:WBGene00011053 Length:186 Species:Caenorhabditis elegans


Alignment Length:179 Identity:53/179 - (29%)
Similarity:89/179 - (49%) Gaps:12/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWT--ESKTDSNNKSTSES-- 67
            :|| :....|:.|||.::|:|..||......:.|.::|.|.:.|.:|  ||:|.:|:|..||:  
 Worm     6 VLF-DKPNAVYAAGQKISGRVVFSTASQQNPRWIDVQLHGRSHTFFTRQESETKTNSKGESETKT 69

  Fly    68 ----YNGFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPIN-CPSSFEGTHGRIRYMVDVN 127
                |....|:|.:.| .|..:......|.||...:.|...:|.: .|.||||.:|.|||.|...
 Worm    70 HTVHYTATAKHLDTAV-PLWRKTDKAARLLPGKYEWQFWFQLPCSVLPPSFEGNNGNIRYWVRAE 133

  Fly   128 IIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRS 176
            :.:.||::.:...:|.:...:|:||. .:::.|:.....|..|...||:
 Worm   134 VSRSWKFNIVDESSFEIAPFLDLNTM-PIARTPLDGFAVKNLGCCCFRN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 46/152 (30%)
Arrestin_C 175..301 CDD:280848 1/2 (50%)
arrd-12NP_001309576.1 Arrestin_N 6..157 CDD:389964 46/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.