DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-3

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496010.2 Gene:arrd-3 / 187498 WormBaseID:WBGene00006429 Length:287 Species:Caenorhabditis elegans


Alignment Length:250 Identity:52/250 - (20%)
Similarity:102/250 - (40%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTE---------SKTDSNNKSTSESYNGFEKYLS 76
            :.|.|.|.:...|.::.:.:|:.:|||.:|.|.|         .....|.|||.:..:..|....
 Worm    19 ECVTGNVVIINRKELKARTLRVYIKGYQKTSWKEIQQKPSLVVRSNGVNVKSTIKLKSHGENIQY 83

  Fly    77 SKVYL-LGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSR 140
            ..:|: |.:..|....::|||..:.|:..:|.:||                              
 Worm    84 IHLYMTLWNFTSDTDCIKPGTHKFPFSFKLPADCP------------------------------ 118

  Fly   141 AFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNE 205
                 .::...||.......:.....|..||: |:|..::::.:.||...:.|:.:|..:||.|:
 Worm   119 -----P
IVPNATYIPKDLQQINGAVSKNIGVF-FKSGIVSVKTSFPQRVLITGEVIPLTLLIDNK 177

  Fly   206 SKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNS--RKMYDFQL 258
            |...|.||.|.:..:..:|:........:||.:.: |:..|..|:  :::.:|::
 Worm   178 STCTVREVGVRIFRIARFYAKDQEKMTRQRKIMIR-KSINVEPNTEQQELIEFKV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 26/139 (19%)
Arrestin_C 175..301 CDD:280848 20/85 (24%)
arrd-3NP_496010.2 Arrestin_N 4..>119 CDD:389964 26/134 (19%)
Arrestin_C 147..275 CDD:214976 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.