DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-6

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001254290.1 Gene:arrd-6 / 185541 WormBaseID:WBGene00009579 Length:469 Species:Caenorhabditis elegans


Alignment Length:351 Identity:96/351 - (27%)
Similarity:151/351 - (43%) Gaps:48/351 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKY-LSSKV 79
            |:|||:.::|.|.|...:.|:|:.||:.|:|  :.|.|.....|..:.|.:.    ::| |..|.
 Worm    42 VYYAGETISGSVLLENTENIKIRGIRVLLRG--KVHATLKVVKSGERRTLKD----DQYVLDEKQ 100

  Fly    80 YLLGSEISPEMALEP----GTRSYNFACPIP-INCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFS 139
            .|.|.:.|.|....|    |...::|...:| .:.|.|.|..|..|||...|.|..|:.......
 Worm   101 LLWGKDKSDESDSVPILARGVHQFSFNFDLPQSSLPCSLESRHCTIRYYFKVIIDIPYASSPQGI 165

  Fly   140 RAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGN 204
            :.||:|. ..|::.......|:.|:..|....|..:...|.|.:.|.:|.:|.|:.:.....|.|
 Worm   166 KYFTIIG-PH
IDSMEEKYLSPLSAQDRKVNCCWCCQRGALALRIILERTAYVCGENIRVRAQIEN 229

  Fly   205 ESK------IR-VHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDFQL---- 258
            ...      || |..|:|.:...:...:.:.|....|.||.|      :..||:..||..|    
 Worm   230 RQSTAQSLVIRLVQHVEVFVEKGLLGENKMMSCVVFEHKSPA------IAANSQGKYDSTLEQPI 288

  Fly   259 MIPSTPPSCFHLCRIIKIGYQIEV-VAKVKG---MHINGTLIMPVTICGVP-----ISPSAVQYT 314
            .:|..||:...:||:|:|.|.:.| :...||   :||:    .|:|:..:|     ..|..|.|.
 Worm   289 RLPVVPPTLVGVCRLIQIYYALRVCMEDEKGNECLHID----FPLTVATIPYRIPNAPPPPVDYD 349

  Fly   315 PQSSGPE-----APEQRALTLIEGEG 335
            ..|:..|     :||.|...:.:|||
 Worm   350 FCSNHVEGGKYVSPEFRLGQVYDGEG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 41/140 (29%)
Arrestin_C 175..301 CDD:280848 37/140 (26%)
arrd-6NP_001254290.1 Arrestin_N 34..174 CDD:278754 41/138 (30%)
Arrestin_C 201..336 CDD:214976 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.