DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-28

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_509710.2 Gene:arrd-28 / 184759 WormBaseID:WBGene00009000 Length:650 Species:Caenorhabditis elegans


Alignment Length:287 Identity:57/287 - (19%)
Similarity:107/287 - (37%) Gaps:79/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QIKAIRLKLKGYAETH--WTESKTDSNNKSTSESYNGFEKYLSSKVYLLGSEISPEMALEPGTRS 98
            :::::||.|.|.....  |.|                   :|..|..   :.:|.|..|.||..:
 Worm   362 ELRSLRLILTGEVRVGGLWYE-------------------FLRFKAI---ANLSHETLLSPGEHN 404

  Fly    99 YNFACPIPINCPSSFE-----GTHG-RIRYMVDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVS 157
            :.|..|.   ..|.::     .|.| .|:||:..:.:...|  :.|.:...::....|:|:...:
 Worm   405 FRFQLPF---ADSQYDTSILPPTLGDEIKYMIHASTVSLPK--NFFQQQCELLVDRFIDTWAKEA 464

  Fly   158 QVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNE-----------SKIRVH 211
            ..|            |:..:....:::|.|..|..|:.|.. .|.|:|           .::||.
 Worm   465 YKP------------PYTEEYGATKIHLSQRCFKRGKHVIV-ALQGSEPRYVKGTLVQKKRLRVP 516

  Fly   212 EVKVGLSMMITYYSDLSSGSKCERKSVAKLKADGVLRNSRKMYDFQLMIPSTPPSCFHLC--RII 274
            .||:             ..|.|.:::| ::..:.:   .||.:...:.||...|....:|  .::
 Worm   517 NVKL-------------DESYCSQRNV-RIFEENI---HRKDHIHVMHIPFNIPPSIEICYWNVL 564

  Fly   275 KIGYQIEVVAKVKGMHINGTLIMPVTI 301
            :|.|..||...::|.|.:...| |:.|
 Worm   565 QIEYHYEVEITLEGGHTHNHSI-PIWI 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 23/122 (19%)
Arrestin_C 175..301 CDD:280848 29/138 (21%)
arrd-28NP_509710.2 Arrestin_C 153..278 CDD:214976
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.