DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-9

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496661.1 Gene:arrd-9 / 184515 WormBaseID:WBGene00008843 Length:312 Species:Caenorhabditis elegans


Alignment Length:302 Identity:73/302 - (24%)
Similarity:116/302 - (38%) Gaps:56/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVYLL 82
            |.|..|:|.:.|..:|....:||.|.:||.|||.|     |:..|.      |...|.:....|.
 Worm    20 YPGDTVSGHIVLKFEKFSTCRAITLTVKGKAETGW-----DNVTKV------GQWTYFNESGVLW 73

  Fly    83 GSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTVIQV 147
            .:|:| |..:||||....|...:|.|.|.||||..|.||:.:.|::.:|...|....:.|.|.|.
 Worm    74 KAEMS-ENRIEPGTHRIPFDYTVPENIPQSFEGPFGFIRFYIKVHMDRPHALDQCVKKEFLVTQK 137

  Fly   148 MDINTYNSV----------------SQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTV 196
            ..:.:...:                .::..:|:.....   .|..||::|.:.            
 Worm   138 PTVVSKKHLGPEHIIRYCQKLNCNRGEIYFEAQLSNRI---IFFDDPISLIIK------------ 187

  Fly   197 PANVLIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKL-KADGVLRNSR---KMYDFQ 257
                 |.|.|...:.::.:.....|.|||..|:..|.....:.|. |::..:||..   ..:..:
 Worm   188 -----IKNCSSRTIKKISLEAFQRIEYYSTTSACRKTHSVLIGKTGKSELKIRNDEIAISTFSMK 247

  Fly   258 LMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPV 299
            ...|:||.....|   |::.|.:.|.....|... ..|:.||
 Worm   248 FKEPATPSFASEL---IQVSYVLLVNLFTDGFWA-APLVFPV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 44/132 (33%)
Arrestin_C 175..301 CDD:280848 27/129 (21%)
arrd-9NP_496661.1 Arrestin_N 10..137 CDD:389964 43/128 (34%)
Arrestin_C 162..277 CDD:214976 26/137 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.