DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-14

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496881.1 Gene:arrd-14 / 175021 WormBaseID:WBGene00011055 Length:356 Species:Caenorhabditis elegans


Alignment Length:368 Identity:87/368 - (23%)
Similarity:141/368 - (38%) Gaps:77/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNG 70
            ||.|...   |::.|..|.|:..:||.|.::..::.:...|                .|..::||
 Worm     9 QISFEKE---VYFPGDEVKGRAWVSTTKNLKATSVEITFSG----------------KTITAHNG 54

  Fly    71 FEKYLSSKVYLLGSEISPEMALE------------PGTRSYNFACPIPINCPSSFEGTHGRIRYM 123
             :|.:..|....|.|...||..|            .|...:||:..:|.:||.||||.:|.|||.
 Worm    55 -KKIIKDKKCKKGEETYVEMKHEVWTPEDTENTFPSGDYEWNFSFELPKDCPPSFEGKYGFIRYS 118

  Fly   124 VDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTF----GVWPFRSDPLTLELN 184
            |.::|..|........||.||..::|:|..|:.....:.......:    ...|.|.: :...|.
 Worm   119 VLLHIAVPNGKPINVERAVTVSSMVDLN
AVNAHEPAKIHVDNVAEYCHCLPCLPTRGN-VIYTLQ 182

  Fly   185 LPQTGFVPGQTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADG---- 245
            .|:.|:|.|:.|..:..|.|.:...:..:...|:..|||..:|.:      |:.||.||||    
 Worm   183 SPKCGYVAGENVIVSGQIENGTSKPMKIITAKLTRRITYREELKA------KANAKKKADGADGF 241

  Fly   246 -----------------VLRNSRKMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHING 293
                             |...|.|.:.|...||:. .|.....|::.:.|.:.|.......:..|
 Worm   242 KSKLEEQILETKIERCNVPARSSKDFAFSFDIPAV-VSTIRSSRLLAVEYFVTVWGDTGTCNRGG 305

  Fly   294 TLIMPVTICGVPISPSAVQYTPQSSGPEAPEQRALTLIEGEGA 336
            ...:.:.:..||:      :...||.|  |.:    .::||.|
 Worm   306 VAALNIIVGNVPL------FLGSSSLP--PRK----FVDGEDA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 43/156 (28%)
Arrestin_C 175..301 CDD:280848 32/146 (22%)
arrd-14NP_496881.1 Arrestin_N 6..146 CDD:334019 43/156 (28%)
Arrestin_C 173..318 CDD:214976 33/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.