DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-2

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496008.1 Gene:arrd-2 / 174491 WormBaseID:WBGene00013086 Length:334 Species:Caenorhabditis elegans


Alignment Length:373 Identity:79/373 - (21%)
Similarity:146/373 - (39%) Gaps:67/373 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGF 71
            |:|.|.:: .:..|..|:|:|.|:|...|..:.:.:..||.::.::..|::.:..:..:.::.|:
 Worm     5 IVFSNPSK-TYLPGDYVSGKVLLTTKDPISARYMEITWKGESKCNFGGSESSNVQRHLAGTFMGW 68

  Fly    72 EKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDS 136
                   :...|.:..|     .||....|...:|.|.|.||.|..|.|.|.|.|...:||:...
 Worm    69 -------IAKDGVDTIP-----AGTLKSRFRFRLPENSPPSFCGMFGEIEYSVTVEFDRPWRLKL 121

  Fly   137 IFSRAFTVIQVMDINTYNSVSQVP----VQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVP 197
            .....|.|:|..:: |.:....:.    |::|...|.    |:.....|:|:..:..|:.|:|:.
 Worm   122 KMMNTFRVVQKTNL
-TLSEPKMMKYAEFVKSKNSGTI----FKDGLFLLKLHFSKRAFLAGETIR 181

  Fly   198 ANVLIGNESKIRVHEVKVGLSMMITYYS----DLSSGSKCERKS--VAKLKADG--VLRNSR--- 251
            |..::.|.|...:..::..|.....|:|    .|.|.:.|....  .:|.:.||  |||.:.   
 Worm   182 ALAIMENHSTKPIINLRFELIQQSHYHSRPQKSLCSLNDCHSDCPIESKYRRDGETVLRGANYSC 246

  Fly   252 -------KMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPS 309
                   |..:.::.:|:..|..|. ..:|.:||.:....:      ||:|......|...|...
 Worm   247 DVAPGEVKYINVEIDLPNGLPPTFE-SPMISMGYLLGFTLR------NGSLTGNRLACNARIVVG 304

  Fly   310 AVQYTPQSSGPEAPEQRALTLIEGEGAFAPAAPPYPWSEGSTLSPPNY 357
            :.:...:......|.:::..|                    |.|||.|
 Worm   305 SEETIDEMVDECEPTKKSQCL--------------------TASPPPY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 35/143 (24%)
Arrestin_C 175..301 CDD:280848 30/143 (21%)
arrd-2NP_496008.1 Arrestin_N 3..135 CDD:389964 35/142 (25%)
Arrestin_C 159..305 CDD:367164 32/152 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.