DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and arrd-1

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_493774.2 Gene:arrd-1 / 173454 WormBaseID:WBGene00020205 Length:291 Species:Caenorhabditis elegans


Alignment Length:334 Identity:64/334 - (19%)
Similarity:120/334 - (35%) Gaps:65/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSKVY 80
            |:|.|..:...|::.|.:.:..:::..:.:|:            .|::.|    ...||..:.:.
 Worm    16 VYYPGDNMKLTVSVDTKRPLNARSVMFRCRGF------------RNRTVS----FLNKYGIAWIC 64

  Fly    81 LLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTVI 145
            ..|....|...||     ..|...:..:||.:::  .|:|.|.|.:.|.|||.......:.|.::
 Worm    65 KDGKNELPVGRLE-----QKFQFELGKDCPPTYK--DGKIIYKVRLEIDQPWSRPLFIEKEFKMV 122

  Fly   146 QVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNESKIRV 210
            ..:   ....:|||.....:.:...:  |.:...|.::.:|:....||:|....:.:.|.|...|
 Worm   123 HKL---ADQKMSQVMTYTSSPRFDAL--FSNGQPTFKVTMPKFTLYPGETTEFKLEVENHSSSTV 182

  Fly   211 HEVKVGLSMMITYYSDLSSGSKCERKSVAKLKADG-----VLRNSRKMYDFQLMIPSTPPSCFHL 270
            .::          |::|.:............||.|     |...|.:.:.....||:...:.||.
 Worm   183 KKI----------YAELEAEPFPLYHIYGNTKAKGKMHVLVAPYSTQKFTIPFTIPTDLTASFHT 237

  Fly   271 CRIIKIGYQIEVVAKVKGMHINGTLIMPVTICGVPISPSAVQYTPQSSGPEAPEQRALTLIEGEG 335
            |     |..::...|. |:         ||...:...|:.....  |.|....|::     :.|.
 Worm   238 C-----GSSLKYTMKF-GL---------VTDSWLTTDPALALVV--SIGELESEEK-----KDEA 280

  Fly   336 AFAPAAPPY 344
            ...|..|||
 Worm   281 LKTPPPPPY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 26/134 (19%)
Arrestin_C 175..301 CDD:280848 24/130 (18%)
arrd-1NP_493774.2 Arrestin_N 8..122 CDD:389964 26/128 (20%)
Arrestin_C 147..269 CDD:214976 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.