DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and Txnip

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001008767.1 Gene:Txnip / 117514 RGDID:620886 Length:394 Species:Rattus norvegicus


Alignment Length:394 Identity:81/394 - (20%)
Similarity:167/394 - (42%) Gaps:64/394 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNG 70
            :::| |:.:.|:.:|:.|||:||:...:..::||:|:...|.|:..|.:.....  |.|.: |..
  Rat    11 EVVF-NDPEKVYGSGEKVAGRVTVEVCEVTRVKAVRILACGVAKVLWMQGSQQC--KQTLD-YLR 71

  Fly    71 FEKYLSSKVYLLGSEISPE---MALEPGTR-SYNFACPIPIN-CPSSFEGTHGRIRYMVDVNIIQ 130
            :|..|     ||..:.:.|   :.:.||.: .|.|...:|.. ..:||:|.:|.:.|.|...:.:
  Rat    72 YEDTL-----LLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDR 131

  Fly   131 PWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQT 195
            |.:......:.|.|:.::|:||.:.::  ||.||.||...........:::...:.:.||..|..
  Rat   132 PSQPTQEAKKNFEVMDLVDVN
TPDLMA--PVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDD 194

  Fly   196 VPANVLIGNE-SKIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMY-DFQ 257
            :..:....|. |:|.|.:..:     :..::.|::| :|...:.::.::.:.::..:...: ...
  Rat   195 ISIHADFENTCSRIVVPKAAI-----VARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKS 254

  Fly   258 LMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTI--------------------- 301
            |.:....||... |.|:::.|.:.:...|.|.. ...|.:|:.|                     
  Rat   255 LRVQKIRPSILG-CNILRVEYSLLIYVSVPGSK-KVILDLPLVIGSRSGLSSRTSSMASRTSSEM 317

  Fly   302 ----CGVPISPSA----VQYTPQSSGPEAPEQRALTLIEGEGAFAPA---APPYPWSEGSTLSPP 355
                ..:|.:|.|    :...|:....|:|....|..:: :...:|.   ||.:.:     :.||
  Rat   318 SWIDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDVD-DSQDSPIFMYAPEFQF-----MPPP 376

  Fly   356 NYAE 359
            .|.|
  Rat   377 TYTE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 38/149 (26%)
Arrestin_C 175..301 CDD:280848 20/128 (16%)
TxnipNP_001008767.1 Arrestin_N 10..152 CDD:304627 38/149 (26%)
Arrestin_C 174..298 CDD:280848 21/130 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm12328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.