DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and TXNIP

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_016855574.1 Gene:TXNIP / 10628 HGNCID:16952 Length:395 Species:Homo sapiens


Alignment Length:396 Identity:83/396 - (20%)
Similarity:165/396 - (41%) Gaps:68/396 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNG 70
            :::| |:.:.|:.:|:.|||:|.:...:..::||:|:...|.|:..|.:.....  |.||| |..
Human    11 EVVF-NDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQC--KQTSE-YLR 71

  Fly    71 FEKYLSSKVYLLGSEISPE---MALEPGTR-SYNFACPIPIN-CPSSFEGTHGRIRYMVDVNIIQ 130
            :|..|     ||..:.:.|   :.:.||.: .|.|...:|.. ..:||:|.:|.:.|.|...:.:
Human    72 YEDTL-----LLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDR 131

  Fly   131 PWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQT 195
            |.:......:.|.|:.::|:||.:.::  ||.||.||...........:::...:.:.||..|..
Human   132 PSQPTQETKKNFEVVDLVDVNTPDLMA--PVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDE 194

  Fly   196 VPANVLIGNE-SKIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMY-DFQ 257
            :..:....|. |:|.|.:..:     :..::.|::| :|...:.::.::.:.::..:...: ...
Human   195 ISIHADFENTCSRIVVPKAAI-----VARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKS 254

  Fly   258 LMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMHINGTLIMPVTI--------------------- 301
            |.:....||... |.|:::.|.:.:...|.|.. ...|.:|:.|                     
Human   255 LRVQKIRPSILG-CNILRVEYSLLIYVSVPGSK-KVILDLPLVIGSRSGLSSRTSSMASRTSSEM 317

  Fly   302 ----CGVPISPSA----VQYTPQSSGPEAPEQRALTLIEGEG-----AFAPAAPPYPWSEGSTLS 353
                ..:|.:|.|    :...|:....|:|....|..::|..     .:||        |...:.
Human   318 SWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAP--------EFKFMP 374

  Fly   354 PPNYAE 359
            ||.|.|
Human   375 PPTYTE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 39/149 (26%)
Arrestin_C 175..301 CDD:280848 20/128 (16%)
TXNIPXP_016855574.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8525
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.