DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18748 and txnip

DIOPT Version :9

Sequence 1:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_002938510.2 Gene:txnip / 100492126 XenbaseID:XB-GENE-968442 Length:388 Species:Xenopus tropicalis


Alignment Length:383 Identity:79/383 - (20%)
Similarity:157/383 - (40%) Gaps:59/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSESYNGFEKYLSSK 78
            |.|:..|:.|.|:|.:...:..::.|:|:...|.|:..|::     |.|...| |..||..|..:
 Frog    18 QKVYCGGEKVTGKVLVEVAEVTRVTAVRVLACGVAKVLWSQ-----NCKQEME-YLRFEDTLQME 76

  Fly    79 VYLLGSEISPEMALEPGT-RSYNFACPIPIN-CPSSFEGTHGRIRYMVDVNIIQPWKYDSIFSRA 141
            .....|:.|  :.:.||. ..|.|...:|.. ..|||:|.:|.::|.|...:.:|........:.
 Frog    77 EQPTDSDGS--VIMRPGNFYEYKFGFELPQGPLGSSFKGKYGSVKYWVKAFLDRPSHPPQEAQKH 139

  Fly   142 FTVIQVMDINTYNSVSQVPVQAKTEKTFGVWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNES 206
            |.|...::::|.:.:|  ||..|..|...........:::...:.:.||..|:    ::.|..:.
 Frog   140 FQV
EDSVNVDTPDLMS--PVSGKKYKKMTCMFIPDGHISMSACINRKGFCEGE----DICISADF 198

  Fly   207 KIRVHEVKVGLSMMITYYSDLSSG-SKCERKSVAKLKADGVLRNSRKMYDF----QLMIPSTPPS 266
            :.....:.|..:.:|:.::.|::| :|...:.:..::.:.::..   |.|.    .:.:|...||
 Frog   199 ENTCSRIVVPKAAIISKHTYLANGQTKVFTQKLCSVRGNHIISG---MTDSWRGKSIRVPKIKPS 260

  Fly   267 CFHLCRIIKIGYQIEVVAKVKG---MHINGTLI-------------------------MPVTICG 303
            ... |.|:::.|.:.|...|.|   :.:|..|:                         :.:.|.|
 Frog   261 ILG-CNILRVEYSLLVYVSVPGAKKIILNLPLVIGSSSSGMNSRTSSMASQASSEMSWIELNIPG 324

  Fly   304 VPISPSA-VQYTPQSSGPEAPEQRALTLIEGEGAFAPAAPPYPWS-EGSTLSPPNYAE 359
            .|.:|.. :...|:....|:|....|..::|    |..:|.:.:: |...:.||.|.|
 Frog   325 TPEAPPGYLDIVPEDHRLESPTTPLLDDLDG----ACDSPIFMYAPEFKYMPPPTYTE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 35/138 (25%)
Arrestin_C 175..301 CDD:280848 22/158 (14%)
txnipXP_002938510.2 Arrestin_N 10..142 CDD:389964 34/131 (26%)
Arrestin_C 172..296 CDD:214976 22/131 (17%)
Periplasmic_Binding_Protein_Type_2 <336..>370 CDD:389745 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4245
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm9421
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.